DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Nmdar2

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001014714.1 Gene:Nmdar2 / 31107 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster


Alignment Length:471 Identity:98/471 - (20%)
Similarity:171/471 - (36%) Gaps:119/471 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 KYIEAPGRTQGSMRSEDGK---DSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSFFTLA 339
            |:.|..|.|...:|.||||   ..|..:.|.|..|.:.:.|..|..:.::.||...::|| ....
  Fly   573 KFAEELGFTYELVRVEDGKWGTLENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFS-EPFM 636

  Fly   340 DSGAFATHAPRR-LNEALAIMRPFKQDIWPHLILTIIFSGPIFYGIIALP----YIWRRRWANSD 399
            ::|.....|.|. :....|.:.||....|            :..||:|:.    .|:...|.:..
  Fly   637 ETGIAIVVAKRTGIISPTAFLEPFDTASW------------MLVGIVAIQAATFMIFLFEWLSPS 689

  Fly   400 VEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCN-ELHNGYR 463
            ...: :||:..|   .:||....|                .:..|....:..:.:.: :...|:.
  Fly   690 GYDM-KLYLQNT---NVTPYRFSL----------------FRTYWLVWAVLFQAAVHVDSPRGFT 734

  Fly   464 AKFLTIVYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYRLYVEKESSSLEM 528
            ::|:|.|:.:.|...|| :|:|.|.:...........:.|.  .:.::|.    :..|.|     
  Fly   735 SRFMTNVWALFAVVFLA-IYTANLAAFMITREEFHEFSGLN--DSRLVHP----FSHKPS----- 787

  Fly   529 LENGT-----------ELFRQLYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKAVLGGRETL 582
            .:.||           :.|..::..|||        :...||..|:..:..|..|..:..| ..|
  Fly   788 FKFGTIPYSHTDSTIHKYFNVMHNYMRQ--------YNKTSVADGVAAVLNGNLDSFIYDG-TVL 843

  Fly   583 FFNVQQ------------YGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKM 635
            .:.|.|            |....:.|:....::|    ||:       .|..|::...:|.|:::
  Fly   844 DYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKY----VQM-------FNKRLLEFRANGDLERL 897

  Fly   636 TAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVGSLAAGV 700
                  ::|......|  .|..:.|:|:              ||.|.....||:.|..|.|.|.:
  Fly   898 ------RRYWMTGTCR--PGKQEHKSSD--------------PLALEQFLSAFLLLMAGILLAAL 940

  Fly   701 ILLLEIVFIKLDQARL 716
            :||||.|:.|..:.||
  Fly   941 LLLLEHVYFKYIRKRL 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 19/62 (31%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/98 (20%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 28/163 (17%)
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436 78/407 (19%)
Lig_chan 665..928 CDD:278489 59/348 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.