DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and GRIN2D

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_000827.2 Gene:GRIN2D / 2906 HGNCID:4588 Length:1336 Species:Homo sapiens


Alignment Length:521 Identity:93/521 - (17%)
Similarity:160/521 - (30%) Gaps:186/521 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AIALTQIVRGLQQSSLAILA----LPSLALSDGVCQKERNVYLDDFLQRLHRSNYKSVVFSQTEL 93
            |..:..:.||.|    |:|.    ||.|...   |:.:...:..:.|.|.    :.::.:...:.
Human   321 AAGVAVVARGAQ----ALLRDYGFLPELGHD---CRAQNRTHRGESLHRY----FMNITWDNRDY 374

  Fly    94 FFQHIEENLQGANECISLILDEPNQLLNSLHDRHLGHRLSLFIFYWGARWPPSSRVIRFREPL-- 156
            .|......:..:...|||..|...:::.|...:.|  ||         ::|..||..||.:|:  
Human   375 SFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTL--RL---------KYPLWSRYGRFLQPVDD 428

  Fly   157 -----------RVVVVTRPRKKAFRIYYNQARPCSDSQLQLVNWYDGDNLGLQRIPLLPTALSVY 210
                       |..|:..|...........:.||. |||                          
Human   429 TQHLTVATLEERPFVIVEPADPISGTCIRDSVPCR-SQL-------------------------- 466

  Fly   211 ANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGRDHRLLMLLSKHMNF 275
                .||      ||||                    ....:.:.|...|....:|..|:..:.|
Human   467 ----NRT------HSPP--------------------PDAPRPEKRCCKGFCIDILKRLAHTIGF 501

  Fly   276 RFK-YIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSFFTLA 339
            .:. |:...|:        .||..:..:.|.||.:...:||..:|.:.::.||.:.::|| ....
Human   502 SYDLYLVTNGK--------HGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFS-VPFV 557

  Fly   340 DSGAFATHAPRRLNEAL---AIMRPFKQDIWPHLI---LTII--------FSGPIFYGIIALPYI 390
            ::|.....|  |.|..:   |.:.|:...:|..:.   ||::        :..|:.|.       
Human   558 ETGISVMVA--RSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYN------- 613

  Fly   391 WRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQ--KCIWFTLRLFLKQ 453
                                               |::.:..:.....|.  |.||....|....
Human   614 -----------------------------------RSLATGKRPGGSTFTIGKSIWLLWALVFNN 643

  Fly   454 SCN-ELHNGYRAKFLTIVYWIAATYVLADVYSAQLTS-----------------QFARPARE-PP 499
            |.. |...|..:|.:.:|:...|...||. |:|.|.:                 :|.||..: ||
Human   644 SVPVENPRGTTSKIMVLVWAFFAVIFLAS-YTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPP 707

  Fly   500 I 500
            :
Human   708 L 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 25/122 (20%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 21/107 (20%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 2/6 (33%)
GRIN2DNP_000827.2 PBP1_iGluR_NMDA_NR2 49..413 CDD:380601 21/113 (19%)
PBP2_iGluR_NMDA_Nr2 430..830 CDD:270436 66/390 (17%)
Glutamate binding. /evidence=ECO:0000250|UniProtKB:Q00959 539..541 0/1 (0%)
Pore-forming. /evidence=ECO:0000250|UniProtKB:Q00960 631..650 6/18 (33%)
Glutamate binding. /evidence=ECO:0000250|UniProtKB:Q00959 717..718
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 900..934
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1225..1336
PDZ-binding. /evidence=ECO:0000250 1334..1336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.