DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Grin2d

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_036008580.1 Gene:Grin2d / 14814 MGIID:95823 Length:1345 Species:Mus musculus


Alignment Length:535 Identity:94/535 - (17%)
Similarity:160/535 - (29%) Gaps:197/535 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AIALTQIVRGLQQSSLAILA----LPSLALSDGVCQKERNVYLDDFLQRLHRSNYKSVVFSQTEL 93
            |..:..:.||.|    |:|.    ||.|...   |:.:...:..:.|.|.    :.::.:...:.
Mouse   323 AAGVAVVARGAQ----ALLRDYGFLPELGHD---CRAQNRTHRGESLHRY----FMNITWDNRDY 376

  Fly    94 FFQHIEENLQGANECISLILDEPNQLLNSLHDRHLGHRLSLFIFYWGARWPPSSRVIRFREPL-- 156
            .|......:..:...|||..|...:::.|...:.|  ||         ::|..||..||.:|:  
Mouse   377 SFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTL--RL---------KYPLWSRYGRFLQPVDD 430

  Fly   157 -----------RVVVVTRPRKKAFRIYYNQARPCSDSQLQLVNWYDGDNLGLQRIPLLPTALSVY 210
                       |..|:..|...........:.||. |||                          
Mouse   431 TQHLTVATLEERPFVIVEPADPISGTCIRDSVPCR-SQL-------------------------- 468

  Fly   211 ANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGRDHRLLMLLSKHMNF 275
                .||..:....|||                    ....:.:.|...|....:|..|:..:.|
Mouse   469 ----NRTHSLVAPRSPP--------------------PDAPRPEKRCCKGFCIDILKRLAHTIGF 509

  Fly   276 RFK-YIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSF---- 335
            .:. |:...|:        .||..:..:.|.||.:...:||..:|.:.::.||.:.::||.    
Mouse   510 SYDLYLVTNGK--------HGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVE 566

  Fly   336 -----------FTLADSG--AFATHAPRRLNEALAIMRPFKQDIWPHLI---LTII--------F 376
                       .|::.|.  |||...|....|      |:...:|..:.   ||::        :
Mouse   567 TGISVMVARSNGTVSPSAFLAFAWLMPPMSPE------PYSPAVWVMMFVMCLTVVAVTVFIFEY 625

  Fly   377 SGPIFYGIIALPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQ- 440
            ..|:.|.                                          |::.:..:.....|. 
Mouse   626 LSPVGYN------------------------------------------RSLATGKRPGGSTFTI 648

  Fly   441 -KCIWFTLRLFLKQSCN-ELHNGYRAKFLTIVYWIAATYVLADVYSAQLTS-------------- 489
             |.||....|....|.. |...|..:|.:.:|:...|...||. |:|.|.:              
Mouse   649 GKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLAS-YTANLAAFMIQEEYVDTVSGL 712

  Fly   490 ---QFARPARE-PPI 500
               :|.||..: ||:
Mouse   713 SDRKFQRPQEQYPPL 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 24/137 (18%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 23/121 (19%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 2/6 (33%)
Grin2dXP_036008580.1 Periplasmic_Binding_Protein_type1 <156..415 CDD:415822 21/113 (19%)
PBP2_iGluR_NMDA_Nr2 432..849 CDD:270436 67/404 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.