DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and GRIN3A

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_597702.2 Gene:GRIN3A / 116443 HGNCID:16767 Length:1115 Species:Homo sapiens


Alignment Length:511 Identity:96/511 - (18%)
Similarity:173/511 - (33%) Gaps:169/511 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 NNSFEEDEEFNSL----DSIEKRKVRVTGGRDHRLLMLLSKHMNFRFK-YIEAPGRTQGSMRSED 294
            |:|...|..|:||    |::..:..:...|....||..:::.|||.|. ||...|:.        
Human   549 NDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKY-------- 605

  Fly   295 GKDSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFS--FF------------TLADSGAFA 345
            |...|..:||.:|.|..|.|...:....::..|.:.|:|:  ||            |.|..||| 
Human   606 GAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAF- 669

  Fly   346 THAPRRLNEALAIMRPFKQDIWPHLILTIIFSGPIFYGIIALPYIWRRRWA-------NSDVEHL 403
                         |.|....:|..:.:.:..:. :|..:    |.|:..:.       .|.|...
Human   670 -------------MWPLHWTMWLGIFVALHITA-VFLTL----YEWKSPFGLTPKGRNRSKVFSF 716

  Fly   404 GELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLT 468
            ... :::.|.. :..|.:.:||              .||                   :..:||.
Human   717 SSA-LNICYAL-LFGRTVAIKP--------------PKC-------------------WTGRFLM 746

  Fly   469 IVYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIH---DGYRLYVEKESSSLEMLE 530
            .::.|...:.|: .|:|.|.   |....|.....|..:....:|   .|:|....:|||:.:.:.
Human   747 NLWAIFCMFCLS-TYTANLA---AVMVGEKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVR 807

  Fly   531 NGTELFRQLYALMRQQVI-----------NDPQ---GFFID--------SVEAGIKLIAEGGEDK 573
               :.|.:::..||:..:           |||:   .|.:|        |::|..||:..|..  
Human   808 ---QSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVGKP-- 867

  Fly   574 AVLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAA 638
                      |.::.||                :.:....|...:::.::.|....|.:|.:   
Human   868 ----------FAIEGYG----------------IGLPPNSPLTANISELISQYKSHGFMDML--- 903

  Fly   639 EYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVG 694
             :.|.|:.|..         .|.|.|.:.|        ..:.::...|.|:.|.:|
Human   904 -HDKWYRVVPC---------GKRSFAVTET--------LQMGIKHFSGLFVLLCIG 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 30/121 (25%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 22/107 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 28/165 (17%)
GRIN3ANP_597702.2 PBP1_iGluR_NMDA_NR3 30..497 CDD:107372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..118
ANF_receptor 127..469 CDD:279440
PBP2_iGluR_NMDA_Nr3 512..908 CDD:270438 86/459 (19%)
Lig_chan 676..942 CDD:278489 59/362 (16%)
PPP2CB binding site. /evidence=ECO:0000250 951..987
GIT1-binding. /evidence=ECO:0000250|UniProtKB:Q9R1M7 1062..1095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.