DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and LOC100149482

DIOPT Version :9

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:XP_009290417.1 Gene:LOC100149482 / 100149482 -ID:- Length:1959 Species:Danio rerio


Alignment Length:463 Identity:92/463 - (19%)
Similarity:149/463 - (32%) Gaps:154/463 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RWPPSSRVIRFREP------LRVVVVTRPRKKAFRIYYNQARPCSDSQLQLVNWYDG----DNLG 196
            |:|..||...|.:|      ||||.:   .::.|.|            ::|.:...|    |::.
Zfish   415 RYPAWSRYGPFLQPPDDAQHLRVVTL---EERPFVI------------VELADAASGTCIRDSVP 464

  Fly   197 LQRIPLLPTALSVYANFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKVRVTGGR 261
            .:| ||..:||....             :|    |..|...|..|        |.||..|:.|..
Zfish   465 CRR-PLNASALQEGV-------------AP----VKQCCKGFCID--------ILKRLARIVGFT 503

  Fly   262 DHRLLMLLSKHMNFRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSWE 326
            ....|:...||                      ||..:..:.|.:|.:...:||..:|.:.::.|
Zfish   504 YDLYLVTNGKH----------------------GKKIDGVWNGMVGEVVYKRADMAIGSLTINEE 546

  Fly   327 RRKAIEFSF------FTLADSGAFATHAPRRLNEALAIMRPFKQDIWPHLI---LTII------- 375
            |.:.::||.      .::..|.:..|.:|.      |.:.|:...:|..:.   ||::       
Zfish   547 RSEVVDFSVPFVETGISVMVSRSNGTVSPS------AFLEPYSPAVWVMMFVMCLTVVAVTVFIF 605

  Fly   376 -FSGPIFYGIIALPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLF 439
             |..|:.|.                                          |::.|..:.....|
Zfish   606 EFFSPVGYN------------------------------------------RSLQSGKKAGGSKF 628

  Fly   440 Q--KCIWFTLRLFLKQSCN-ELHNGYRAKFLTIVYWIAATYVLADVYSAQLTSQFARPAREPPIN 501
            .  |.||....|....|.. |...|..:|.:.:|:...|...||. |:|.|.   |...:|..|:
Zfish   629 TIGKSIWLLWALVFNNSVPVENPKGTTSKIMVLVWAFFAVIFLAS-YTANLA---AFMIQEEYID 689

  Fly   502 TLQRLQAAMIHDGYRLYVEKESSSLEMLENGT--ELFRQLYALMRQQVINDPQGFFIDSVEAGIK 564
            |:..|...........|...:..:   :.||:  :..|..|..|.|.::...|    .|||..|.
Zfish   690 TVSGLSDKKFQHPTEQYPPLKFGT---VPNGSTEKNIRSNYPDMHQYMVKYNQ----KSVEDAIS 747

  Fly   565 LIAEGGED 572
            .:..|..|
Zfish   748 HLKTGKLD 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 24/127 (19%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/110 (18%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 18/79 (23%)
LOC100149482XP_009290417.1 PBP1_iGluR_NMDA_NR2 44..421 CDD:107373 2/5 (40%)
PBP2_iGluR_NMDA_Nr2 433..831 CDD:270436 86/445 (19%)
HisJ <487..>570 CDD:223904 22/112 (20%)
Lig_chan 585..857 CDD:278489 43/224 (19%)
NMDAR2_C 868..>900 CDD:287527
FAM76 <1763..>1856 CDD:292665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.