DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3635 and LIPF

DIOPT Version :9

Sequence 1:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001185758.1 Gene:LIPF / 8513 HGNCID:6622 Length:408 Species:Homo sapiens


Alignment Length:413 Identity:148/413 - (35%)
Similarity:230/413 - (55%) Gaps:25/413 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MANNSPTRGSVMLLTLVLLLLSRKIGLVDG-----H----KVT---ATSISNHNYPVEEHTVITH 70
            |.:|:.:|..:.||..:..|:| .:|...|     |    :||   :..|:...||.||:.|:|.
Human     1 MFSNANSRSKMWLLLTMASLIS-VLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTE 64

  Fly    71 DDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDDWIINGPEASLAYMLADAGYDVWLGN 135
            |.|||.:.|||.....|  ...|:|.|||||||:|:::.:||.|.|..|||::||||||||||||
Human    65 DGYILEVNRIPYGKKNS--GNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGN 127

  Fly   136 ARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYALAKSQSSSLHFVAHSQGTTAFFVLM 200
            :||||::|::.:..||:.:||.||:.|:..|||.|.:|:.:.|:....||:|.||||||..|:..
Human   128 SRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAF 192

  Fly   201 SSLPLYNEKLRSVHLLAPIAYMRDHSFILSKLGGIFLGTPSFLSWVLGSMELLPITNLQKLICEH 265
            |:.|...:::::.:.|||:|.::....:::||..:   ..|...::.|.....|.....:.:...
Human   193 STNPSLAKRIKTFYALAPVATVKYTKSLINKLRFV---PQSLFKFIFGDKIFYPHNFFDQFLATE 254

  Fly   266 ICSSSSMFNFLCSGLLDFIGGWGTRHLNQTLLPDVCATH-PAGASSSQVIHYLQLYRSGDFRQYD 329
            :| |..|.|.|||..|..|.|:.:::.|.:.| ||..:| |||.|...:.|:.|..:||.|:.||
Human   255 VC-SREMLNLLCSNALFIICGFDSKNFNTSRL-DVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYD 317

  Fly   330 HG-PELNEIIYQQPTPPSYNVQYIKSCVDMYYSENDYMSAVGDVKYLASLLPCAQLYR-IPFRDW 392
            .| |..|.:.|.|..||.|||..:...:.::....|.::...||..|...||....:: |||  :
Human   318 WGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPF--Y 380

  Fly   393 NHYDFLWSNNVKEVINNKIIQKI 415
            ||.||:|:.:..:.:.|.|:..|
Human   381 NHLDFIWAMDAPQEVYNDIVSMI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 27/59 (46%)
Abhydrolase_1 97..399 CDD:278959 115/304 (38%)
LIPFNP_001185758.1 PLN02872 14..400 CDD:215470 142/395 (36%)
Abhydro_lipase 45..107 CDD:282003 27/63 (43%)
Abhydrolase_5 88..>211 CDD:289465 59/122 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141735
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.