DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3635 and CG17097

DIOPT Version :9

Sequence 1:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:417 Identity:136/417 - (32%)
Similarity:225/417 - (53%) Gaps:24/417 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSCAQTNILTSKEMANNSPTRGSVM----LLTLVLLLLSRKIGLVDGHKVTATSISNHNYPVEEH 65
            ::.|::||.|.|...|.......|.    .||...:|.:.|:..||       .|..:.||.|.:
  Fly   683 DNLAESNIQTQKNRINVVTPEYKVFKTPNYLTQEDILDNTKLTTVD-------LIEKYGYPSETN 740

  Fly    66 TVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDDWIINGPEASLAYMLADAGYD 130
            .|.:.|.|.|.::|||         |.|...|: |.||::::|..|:..||:..|||:|...|||
  Fly   741 YVTSEDGYRLCLHRIP---------RPGAEPVL-LVHGLMASSASWVELGPKDGLAYILYRKGYD 795

  Fly   131 VWLGNARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYALAKSQSSSLHFVAHSQGTTA 195
            ||:.|.|||.|||::.:.....:.:|.||:||||.:|:.|.:|:.|..:....:.::.||||:|.
  Fly   796 VWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPKIQYIGHSQGSTV 860

  Fly   196 FFVLMSSLPLYNEKLRSVHLLAPIAYMRDHSFILSKLGGIFLGTPSFLSWVLGSMELLPITNLQK 260
            |||:.|..|.|..|:..:..|:|..|::::...:.|..|:|.|..|.|..:||..|:...|.|.:
  Fly   861 FFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLLNLLGGYEISAKTKLIQ 925

  Fly   261 LICEHICSSSSMFNFLCSGLLDFI-GGWGTRHLNQTLLPDVCATHPAGASSSQVIHYLQLYRSGD 324
            ...:||||.|.:.:.:|: :.||: .|:..:..|.||.|.|.|....|||:.|:.||.||....:
  Fly   926 QFRQHICSGSELGSSICA-IFDFVLCGFDWKSFNTTLTPIVAAHASQGASAKQIYHYAQLQGDLN 989

  Fly   325 FRQYDHGPELNEIIYQQPTPPSYNVQYIKSCVDMYYSENDYMSAVGDVKYLASLLP-CAQLYRIP 388
            |:::|||..||.:.|:...||:||:....|.|.:::.|.|::.:..||..|...|| ..:..::.
  Fly   990 FQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTSDVIRLQERLPNLVESRKVN 1054

  Fly   389 FRDWNHYDFLWSNNVKEVINNKIIQKI 415
            |..::|:||..|.:|:.::.:.:::.:
  Fly  1055 FEGFSHFDFTLSKDVRPLLYSHVLRHL 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 19/59 (32%)
Abhydrolase_1 97..399 CDD:278959 108/303 (36%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 21/70 (30%)
MhpC 746..1061 CDD:223669 113/325 (35%)
Abhydrolase_5 762..>899 CDD:289465 51/137 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439461
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.