DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3635 and LIPJ

DIOPT Version :9

Sequence 1:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:364 Identity:126/364 - (34%)
Similarity:209/364 - (57%) Gaps:9/364 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ISNHNYPVEEHTVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDDWIINGPEAS 119
            ||...||.||:.::|.|.|||.:||||.....::.|.| :|.||:||||:|:::..||.|.|..|
Human     7 ISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLA-QRVVVYLQHGLLTSASSWISNLPNNS 70

  Fly   120 LAYMLADAGYDVWLGNARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYALAKSQSSSL 184
            |.::|||||||||:||:||||:||:|.::...:.:||.||:.|:..|||.|.:|:.:.:::...:
Human    71 LGFILADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQEEI 135

  Fly   185 HFVAHSQGTTAFFVLMSSLPLYNEKLRSVHLLAPIAYMRDHSFILSKLGGIFLGTPSFLSWVLGS 249
            .:|.||||||..|:..|::....|:::....|||:...:   ::.|.|..:.....|.:....|:
Human   136 FYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTK---YLKSPLIRMTYKWKSIVMAFSGN 197

  Fly   250 MELLPITNLQKLICEHICSSSSMFNFLCSGLLDFIGGWGTRHLNQTLLPDVCATH-PAGASSSQV 313
            .:.||.|:.:|.|...:| ...:|:.:|..:|..:.|:..::||.:.| ||..:| |||.|...:
Human   198 KDFLPKTSFKKFIGSKLC-PLQIFDKICLNILFMMFGYDPKNLNMSRL-DVYFSHNPAGTSVQNM 260

  Fly   314 IHYLQLYRSGDFRQYDHG-PELNEIIYQQPTPPSYNVQYIKSCVDMYYSENDYMSAVGDVKYLAS 377
            :|:.||..|...:.||.| |:||.:.|.|.|.|.||:..:.....::..::|.::...||..|.|
Human   261 LHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHS 325

  Fly   378 LLPCAQLYRIPFRDWNHYDFLWSNNVKEVINNKIIQKIR 416
            .: ...:|......:||.|.|:..:|.:.:.::||..|:
Human   326 EI-TNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 27/59 (46%)
Abhydrolase_1 97..399 CDD:278959 103/303 (34%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 27/59 (46%)
Abhydrolase_5 47..209 CDD:289465 61/164 (37%)
Abhydrolase_1 48..347 CDD:278959 104/304 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141757
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.