DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and YPR015C

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_015340.1 Gene:YPR015C / 856125 SGDID:S000006219 Length:247 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:40/168 - (23%)
Similarity:70/168 - (41%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 CGGLFSRYSSLWSHKKL-----HSGEKNYKCSICGLAFAKAVY-LKNHARIHTGEKPYKCQTCGM 428
            |..::|..:|.::.:.:     |..|:|::      |.:...| |.|   :|.|:.|      |.
Yeast   112 CCPIYSTAASSYTAQSVPPSMQHFQEENHR------AVSNEQYSLPN---VHIGQNP------GT 161

  Fly   429 QFSQSPHLKNHERTHSGERPYV-----CGVCDKGFARHATLWNHRRIHTGEKPYKC--EICGSAF 486
            ..||:.  .:.:......|..|     |.:|.|..:|.:||..|..||||:.|:||  |.|..:|
Yeast   162 LLSQTQ--TDLDLIQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSF 224

  Fly   487 SQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHR 524
            :..:::..|.:.|.               .:.|.|:|:
Yeast   225 NVKSNMLRHLRTHQ---------------KKIAKKKHQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 36/140 (26%)
C2H2 Zn finger 367..387 CDD:275368 3/21 (14%)
zf-H2C2_2 379..403 CDD:290200 5/28 (18%)
C2H2 Zn finger 395..415 CDD:275368 4/20 (20%)
zf-H2C2_2 407..432 CDD:290200 7/25 (28%)
C2H2 Zn finger 423..443 CDD:275368 3/19 (16%)
zf-H2C2_2 435..460 CDD:290200 5/29 (17%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
zf-H2C2_2 464..488 CDD:290200 12/25 (48%)
COG5048 475..>529 CDD:227381 11/52 (21%)
C2H2 Zn finger 479..499 CDD:275368 5/21 (24%)
zf-H2C2_2 491..515 CDD:290200 2/23 (9%)
C2H2 Zn finger 507..527 CDD:275368 3/18 (17%)
YPR015CNP_015340.1 COG5048 <17..247 CDD:227381 39/166 (23%)
C2H2 Zn finger 187..207 CDD:275370 7/19 (37%)
C2H2 Zn finger 215..237 CDD:275370 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.