DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and CG14655

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:497 Identity:109/497 - (21%)
Similarity:178/497 - (35%) Gaps:139/497 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NYALVNGMPLNQGAALGIATVDAQGRIQIVNQNKPIAAN---TISNISFKCDVCSDMFPHLALLN 143
            |.:..||.|.:....|..|....:.:   ..::||:...   ..:.....||:|...|.:..|.:
  Fly    67 NESPANGQPASSRGFLAAAPPKRRAK---RTRSKPVVPTPPPVRTTPPAHCDICEFSFRNTELRD 128

  Fly   144 AHKRM-HTDGEQQQQQQHNAQAGGDSIAVVSAQGLVQAQNIIGNGQMGQIQIVSSDTLEPVQQSV 207
            .|.|: |.:.|.:.:|:                                         ||     
  Fly   129 MHVRLVHENAEGEPKQK-----------------------------------------EP----- 147

  Fly   208 MQQQQHESKASKCINCGSSMLQQSKRKGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQII 272
             ||::.:.:..||..|..:.    :.||..::..                      ::.|.:.:.
  Fly   148 -QQKEPDQEPYKCHLCSKTF----RMKGSLRIHL----------------------KVVHMMGVP 185

  Fly   273 STTPQAQAQLQQIVAAQTGG--TTPKREASSGSGHHPVKKRNSQQMTKCQKCNGSGVVLVGQHSH 335
            .:.|..........|:.|..  .|||                   ::.|.:..           |
  Fly   186 CSNPNPNPNPSPTPASTTSAVTATPK-------------------LSICDRIR-----------H 220

  Fly   336 ASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGL 400
            .....:|.....:.|.          |:|::  :.|.|.....|..|.:...:..|.::|.:|..
  Fly   221 TEPGALGNGNNSTCTA----------SQPYA--LSGALSMLQQSPSSPESGTATPKLWECDVCSK 273

  Fly   401 AFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLW 465
            :|....:||.|.|:||||.||.|:.|...|:.......|...||..:|:|||||.:.|...:||.
  Fly   274 SFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLH 338

  Fly   466 NHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHR------ 524
            ||:|||:||||:|||:||..|.|......|.::|:|..|||||:|...|..:.:.:.||      
  Fly   339 NHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFRYKVSQRTHRCPTEEA 403

  Fly   525 ---------GIHQKYGQTAPRQTSSDGMIVHKQEIPDMEDEA 557
                     .:......|.|...|::...::...|.|.|.||
  Fly   404 QTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSSIVDPEQEA 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 52/138 (38%)
C2H2 Zn finger 367..387 CDD:275368 4/19 (21%)
zf-H2C2_2 379..403 CDD:290200 5/23 (22%)
C2H2 Zn finger 395..415 CDD:275368 7/19 (37%)
zf-H2C2_2 407..432 CDD:290200 13/24 (54%)
C2H2 Zn finger 423..443 CDD:275368 4/19 (21%)
zf-H2C2_2 435..460 CDD:290200 10/24 (42%)
C2H2 Zn finger 451..471 CDD:275368 10/19 (53%)
zf-H2C2_2 464..488 CDD:290200 16/23 (70%)
COG5048 475..>529 CDD:227381 21/68 (31%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
zf-H2C2_2 491..515 CDD:290200 9/23 (39%)
C2H2 Zn finger 507..527 CDD:275368 6/34 (18%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
zf-H2C2_2 339..361 CDD:290200 15/21 (71%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 10/24 (42%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.