| Sequence 1: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011509104.1 | Gene: | IKZF2 / 22807 | HGNCID: | 13177 | Length: | 533 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 71/233 - (30%) |
|---|---|---|---|
| Similarity: | 99/233 - (42%) | Gaps: | 17/233 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 331 GQHSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKC 395
Fly 396 SICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFAR 460
Fly 461 HATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRG 525
Fly 526 IHQKYGQTAPRQTSSDGMIVHKQEIPDMEDEAQQEVII 563 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 40/138 (29%) |
| C2H2 Zn finger | 367..387 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 379..403 | CDD:290200 | 4/23 (17%) | ||
| C2H2 Zn finger | 395..415 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 407..432 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 423..443 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 435..460 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 451..471 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 464..488 | CDD:290200 | 11/23 (48%) | ||
| COG5048 | 475..>529 | CDD:227381 | 18/53 (34%) | ||
| C2H2 Zn finger | 479..499 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 491..515 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 507..527 | CDD:275368 | 5/19 (26%) | ||
| IKZF2 | XP_011509104.1 | C2H2 Zn finger | 121..141 | CDD:275368 | 7/19 (37%) |
| zf-H2C2_2 | 134..158 | CDD:290200 | 11/23 (48%) | ||
| COG5048 | 145..>214 | CDD:227381 | 25/68 (37%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 161..186 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 177..197 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 205..226 | CDD:275368 | 5/20 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||