Sequence 1: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036613.2 | Gene: | IKZF3 / 22806 | HGNCID: | 13178 | Length: | 509 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 68/219 - (31%) |
---|---|---|---|
Similarity: | 102/219 - (46%) | Gaps: | 41/219 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 SVKQSVTVKTECL-SCRNPSKPFSCNICGGLFSRYSSLWSHKKLH------------SGEKNYKC 395
Fly 396 SICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFAR 460
Fly 461 HATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAK-------------VHSGE-KPYKCEICS 511
Fly 512 --AAFADRFA---LKRHRGIHQKY 530 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 52/163 (32%) |
C2H2 Zn finger | 367..387 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 379..403 | CDD:290200 | 9/35 (26%) | ||
C2H2 Zn finger | 395..415 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 407..432 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 423..443 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 435..460 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 451..471 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 464..488 | CDD:290200 | 13/23 (57%) | ||
COG5048 | 475..>529 | CDD:227381 | 22/72 (31%) | ||
C2H2 Zn finger | 479..499 | CDD:275368 | 7/32 (22%) | ||
zf-H2C2_2 | 491..515 | CDD:290200 | 8/39 (21%) | ||
C2H2 Zn finger | 507..527 | CDD:275368 | 8/24 (33%) | ||
IKZF3 | NP_036613.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..86 | 4/20 (20%) | |
COG5048 | <79..>219 | CDD:227381 | 51/148 (34%) | ||
C2H2 Zn finger | 120..140 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 133..157 | CDD:316026 | 12/23 (52%) | ||
C2H2 Zn finger | 148..168 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 176..196 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 204..220 | CDD:275368 | 6/15 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 364..394 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |