Sequence 1: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011242004.1 | Gene: | Ikzf1 / 22778 | MGIID: | 1342540 | Length: | 559 | Species: | Mus musculus |
Alignment Length: | 251 | Identity: | 68/251 - (27%) |
---|---|---|---|
Similarity: | 104/251 - (41%) | Gaps: | 54/251 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 262 DGQMAHPV-QIISTTPQAQAQLQQ---IVAAQTGG------TTPKREASSGSGHHPVKKRNSQQM 316
Fly 317 TKCQKCNGSGVV-------LVGQHSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLF 374
Fly 375 SRYSSLWSHKKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNH 439
Fly 440 ERTHSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNH 495 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 45/137 (33%) |
C2H2 Zn finger | 367..387 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 379..403 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 395..415 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 407..432 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 423..443 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 435..460 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 451..471 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 464..488 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 475..>529 | CDD:227381 | 9/21 (43%) | ||
C2H2 Zn finger | 479..499 | CDD:275368 | 6/17 (35%) | ||
zf-H2C2_2 | 491..515 | CDD:290200 | 2/5 (40%) | ||
C2H2 Zn finger | 507..527 | CDD:275368 | |||
Ikzf1 | XP_011242004.1 | Nitro_FMN_reductase | <11..>59 | CDD:382052 | 3/8 (38%) |
C2H2 Zn finger | 163..183 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 176..200 | CDD:372612 | 12/23 (52%) | ||
COG5048 | 187..>535 | CDD:227381 | 29/77 (38%) | ||
C2H2 Zn finger | 191..211 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 203..228 | CDD:372612 | 9/24 (38%) | ||
C2H2 Zn finger | 219..239 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 247..268 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |