DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and AU041133

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001156536.1 Gene:AU041133 / 216177 MGIID:2143755 Length:498 Species:Mus musculus


Alignment Length:448 Identity:136/448 - (30%)
Similarity:193/448 - (43%) Gaps:106/448 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GRIQIVNQNKPIAANTISNISFKCDVCSDMFPHLALLNAHKRMHTDGEQQQQQQHNAQAGGDSIA 170
            |||.  .:.||          ::|..||.:|.:...|..|::.||     :::.:.....|.|. 
Mouse    97 GRIH--TEGKP----------YECKQCSQIFTNFCHLRKHEKKHT-----KEKLYECNHCGKSF- 143

  Fly   171 VVSAQGLVQAQNIIGNG-------QMGQIQIVSSDTLEPVQQSVMQQQQHE-SKASKCINCG--- 224
              .::..:|..|....|       :.|:....||:.|       :.::.|. .|...|.:||   
Mouse   144 --PSRNSLQIHNRTHTGEKPYDCNECGKAFTCSSNLL-------LHKRTHTGEKPYDCSDCGKAF 199

  Fly   225 --SSMLQQSKRK--GPKQVRCESC---------MQAEQTAQQQQQLFVAQDGQMAHPVQIISTTP 276
              ||.||..|||  |.|...|..|         :|..:.:..:::::...               
Mouse   200 ASSSNLQIHKRKHTGEKPYGCNQCGKAFAYSNALQKHERSHTREKIYECN--------------- 249

  Fly   277 QAQAQLQQIVAAQTGGTTPK-REASSGSGHHPVKKRNSQQMTKCQKCNGSGVVLVGQHSH-ASHS 339
                        |.|....: |...:...||.::|     ..:|.:|..:.......:.| .||:
Mouse   250 ------------QCGKAFARHRSLQNHEEHHTLEK-----PYECSQCGKAFAYSSNLYIHERSHT 297

  Fly   340 GVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGLAFAK 404
            |                     .|||.|..||..|..:|||..|::.|:|||.|.|:.||.|||.
Mouse   298 G---------------------EKPFKCTQCGKAFPSHSSLQIHERTHTGEKPYDCNECGKAFAC 341

  Fly   405 AVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLWNHRR 469
            ...|..|.|.|||||||.|..||..|:.|..|:.||:||:||:||.|..|.|.|||.:.|:.|.|
Mouse   342 RSNLLLHKRTHTGEKPYHCIECGKAFACSSSLQKHEKTHTGEKPYECNQCGKAFARRSDLYIHER 406

  Fly   470 IHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIH 527
            ||||||||:|..||.||.....|:.|.:.|:|||||:|..|..||..||:|:.|...|
Mouse   407 IHTGEKPYECNQCGKAFVHCISLQRHERTHTGEKPYECNQCGKAFTRRFSLQVHERSH 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 70/138 (51%)
C2H2 Zn finger 367..387 CDD:275368 8/19 (42%)
zf-H2C2_2 379..403 CDD:290200 12/23 (52%)
C2H2 Zn finger 395..415 CDD:275368 9/19 (47%)
zf-H2C2_2 407..432 CDD:290200 14/24 (58%)
C2H2 Zn finger 423..443 CDD:275368 8/19 (42%)
zf-H2C2_2 435..460 CDD:290200 13/24 (54%)
C2H2 Zn finger 451..471 CDD:275368 9/19 (47%)
zf-H2C2_2 464..488 CDD:290200 16/23 (70%)
COG5048 475..>529 CDD:227381 25/53 (47%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
zf-H2C2_2 491..515 CDD:290200 11/23 (48%)
C2H2 Zn finger 507..527 CDD:275368 8/19 (42%)
AU041133NP_001156536.1 KRAB 4..>47 CDD:214630
KRAB 4..43 CDD:279668
COG5048 104..489 CDD:227381 133/439 (30%)
C2H2 Zn finger 108..128 CDD:275368 6/19 (32%)
C2H2 Zn finger 136..156 CDD:275368 4/22 (18%)
zf-H2C2_2 148..173 CDD:290200 4/24 (17%)
C2H2 Zn finger 164..184 CDD:275368 4/26 (15%)
zf-H2C2_2 176..201 CDD:290200 6/31 (19%)
C2H2 Zn finger 192..212 CDD:275368 9/19 (47%)
zf-H2C2_2 204..229 CDD:290200 9/24 (38%)
C2H2 Zn finger 220..240 CDD:275368 3/19 (16%)
zf-H2C2_2 232..257 CDD:290200 3/51 (6%)
C2H2 Zn finger 248..268 CDD:275368 3/46 (7%)
C2H2 Zn finger 276..296 CDD:275368 3/19 (16%)
zf-H2C2_2 288..311 CDD:290200 10/43 (23%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
zf-H2C2_2 316..341 CDD:290200 13/24 (54%)
C2H2 Zn finger 332..352 CDD:275368 9/19 (47%)
zf-H2C2_2 344..369 CDD:290200 14/24 (58%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
zf-H2C2_2 372..397 CDD:290200 13/24 (54%)
C2H2 Zn finger 388..408 CDD:275368 9/19 (47%)
zf-H2C2_2 400..425 CDD:290200 16/24 (67%)
C2H2 Zn finger 416..436 CDD:275368 7/19 (37%)
zf-H2C2_2 428..453 CDD:290200 12/24 (50%)
C2H2 Zn finger 444..464 CDD:275368 8/19 (42%)
zf-H2C2_2 456..481 CDD:290200 3/9 (33%)
C2H2 Zn finger 472..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.