DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and znf-782

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_500033.1 Gene:znf-782 / 190310 WormBaseID:WBGene00021931 Length:662 Species:Caenorhabditis elegans


Alignment Length:350 Identity:100/350 - (28%)
Similarity:146/350 - (41%) Gaps:92/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QIISTTPQAQAQLQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQMTKCQKCNGSGVVLVGQHS 334
            :::....:...:|:::..:.:..:.    .|:||.|.......|         :||...|..| |
 Worm    35 ELLEEEEEFDEELEELENSDSASSL----VSAGSPHGSSSSNGS---------HGSSPPLQVQ-S 85

  Fly   335 HASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICG 399
            .:..||..||            ....|.|...|.:||..||.:|.|.|||:.|:|||.|.|..|.
 Worm    86 PSQGSGSSGS------------PTGQPEKRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQ 138

  Fly   400 LAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQ---------SPHL--KN--------------- 438
            ..||:...|:.|.|.||||:||||:.|...|:|         |.||  :|               
 Worm   139 KTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSA 203

  Fly   439 ---HERTH-----------------------------SGERPYVCGVCDKGFARHATLWNHRRIH 471
               |::||                             ..||.:||..|:||||...:|..|.|.|
 Worm   204 LYTHKKTHGDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTH 268

  Fly   472 TGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIH--QKYGQTA 534
            |||:||.|:.|..||:...:|::|.:.|:||:||.|:.|...|..:..|..|...|  ||: ...
 Worm   269 TGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKH-SVN 332

  Fly   535 PRQTSSD-----GMIVHKQEIPDME 554
            |..|::|     |.:...|.:.:.|
 Worm   333 PDSTTADILPVAGSVTDHQMVGNYE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 66/196 (34%)
C2H2 Zn finger 367..387 CDD:275368 10/19 (53%)
zf-H2C2_2 379..403 CDD:290200 11/23 (48%)
C2H2 Zn finger 395..415 CDD:275368 7/19 (37%)
zf-H2C2_2 407..432 CDD:290200 13/24 (54%)
C2H2 Zn finger 423..443 CDD:275368 9/48 (19%)
zf-H2C2_2 435..460 CDD:290200 14/73 (19%)
C2H2 Zn finger 451..471 CDD:275368 9/19 (47%)
zf-H2C2_2 464..488 CDD:290200 13/23 (57%)
COG5048 475..>529 CDD:227381 19/55 (35%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
zf-H2C2_2 491..515 CDD:290200 9/23 (39%)
C2H2 Zn finger 507..527 CDD:275368 5/19 (26%)
znf-782NP_500033.1 C2H2 Zn finger 106..126 CDD:275368 10/19 (53%)
zf-H2C2_2 119..143 CDD:290200 12/23 (52%)
C2H2 Zn finger 134..154 CDD:275368 7/19 (37%)
zf-H2C2_2 147..171 CDD:290200 13/23 (57%)
C2H2 Zn finger 162..180 CDD:275368 4/17 (24%)
COG5048 <187..404 CDD:227381 46/171 (27%)
C2H2 Zn finger 191..211 CDD:275370 1/19 (5%)
C2H2 Zn finger 218..239 CDD:275368 0/20 (0%)
C2H2 Zn finger 248..268 CDD:275368 9/19 (47%)
zf-H2C2_2 260..285 CDD:290200 13/24 (54%)
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 288..313 CDD:290200 10/24 (42%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 386..403 CDD:275368
C2H2 Zn finger 424..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.