DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and pat-9

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_510680.2 Gene:pat-9 / 181714 WormBaseID:WBGene00003933 Length:470 Species:Caenorhabditis elegans


Alignment Length:177 Identity:46/177 - (25%)
Similarity:84/177 - (47%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 KAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSG----------ERPYVCGVCDKGF 458
            |:.|::|...:..|..|.....|....:.:..:.|:.:..:.          :|||.|.:|...|
 Worm    29 KSSYMENTPEMVFGSFPIHSGFCTQVVTHTDPMNNNNQPKTNANGRALAADRKRPYPCNLCSSKF 93

  Fly   459 ARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRH 523
            .....|..|:..|||:||::|:.|.:.|::.:.|.||.::||..||:.|.:|...|..:.:||.|
 Worm    94 GSKMELEEHQNSHTGQKPFECDTCNARFNRRSTLWNHKRIHSDAKPFVCTVCQMTFKWKNSLKCH 158

  Fly   524 RGIHQKYGQTAPRQTSSDGMIVH----KQEIPDMEDEAQQEVIIGGL 566
            :.:||:..:|:....:....:.:    |::: .||.|..     |||
 Worm   159 KDMHQRKNETSAHLDNDLRQLTYATAAKRKL-QMEQEEN-----GGL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 26/103 (25%)
C2H2 Zn finger 367..387 CDD:275368
zf-H2C2_2 379..403 CDD:290200
C2H2 Zn finger 395..415 CDD:275368 3/10 (30%)
zf-H2C2_2 407..432 CDD:290200 5/24 (21%)
C2H2 Zn finger 423..443 CDD:275368 2/19 (11%)
zf-H2C2_2 435..460 CDD:290200 7/34 (21%)
C2H2 Zn finger 451..471 CDD:275368 5/19 (26%)
zf-H2C2_2 464..488 CDD:290200 10/23 (43%)
COG5048 475..>529 CDD:227381 19/53 (36%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
zf-H2C2_2 491..515 CDD:290200 9/23 (39%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
pat-9NP_510680.2 C2H2 Zn finger 86..106 CDD:275368 5/19 (26%)
zf-H2C2_2 98..123 CDD:290200 10/24 (42%)
C2H2 Zn finger 114..134 CDD:275368 6/19 (32%)
C2H2 Zn finger 142..162 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.