DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and Zfp384

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_038962888.1 Gene:Zfp384 / 171018 RGDID:708346 Length:680 Species:Rattus norvegicus


Alignment Length:545 Identity:129/545 - (23%)
Similarity:206/545 - (37%) Gaps:132/545 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DAQGRIQIVNQNK--------PIAANTISNISF------------KCDVCSDMFPHL------AL 141
            :.:||::..:.|.        |..:..|.|..|            .|.:....:|.|      ..
  Rat    64 EREGRMEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVS 128

  Fly   142 LNAHKRMHTDGEQQQQQQHNAQAGGDSIAVVSAQGLVQAQNIIGNGQMGQIQIVSSDTLEPVQQS 206
            |::...|.|:.:.:|...|:..:...:|.||.                     |.|..|.....|
  Rat   129 LSSGISMDTESKSEQLTPHSQASVTQNITVVP---------------------VPSTGLMTAGVS 172

  Fly   207 VMQQQQHESKASKCINCGSSMLQQSKRKGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQI 271
            ..|:.:.|.               |:.:||..|..........||..      ||...::.|: |
  Rat   173 CSQRWRREG---------------SQSRGPGLVITSPSGSLVTTASS------AQTFPISTPM-I 215

  Fly   272 ISTTPQAQAQLQQI--VAAQTGGTTPKREASSGSG------HHPVKKRNSQQMTK--CQKCNGSG 326
            :|..|.....||.:  ::.:...|..:.....|.|      ..|.:.|..::|.:  ..:.|...
  Rat   216 VSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGTVAPPKPPRGRKKKRMLESGLPEMNDPY 280

  Fly   327 VVLVGQ----------HSHASHSGVGG----SVKQSVTVKTECLSC------------------- 358
            |:..|.          :....:.|.|.    .:..||...|..|.|                   
  Rat   281 VLAPGDDDDHQKDGKTYRSEGNCGTGNGQSLGLMDSVPGSTTNLLCDPGCRMCSLTFYSKSEMQI 345

  Fly   359 ----RNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTGE- 418
                ...:||..|..|...|:..|.|..|.::|||.|.|.|:.|..:|.:..:|:.|.|||:.. 
  Rat   346 HSKSHTETKPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNFCEKSFRQLSHLQQHTRIHSKMH 410

  Fly   419 ----KPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKC 479
                ||:||..|...|:.:.:|..|.|.|||.:||.|..|.|.|.:.:.|..|.|||||::||||
  Rat   411 TETIKPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTRIHTGDRPYKC 475

  Fly   480 EI--CGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIHQ-KYGQT------AP 535
            ..  |..||:|.::|::|.:.|:.:||:||..|..|:.|..:|:.|...|. |:.:.      :.
  Rat   476 AHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEAHLSTHTVKHAKVYTCTICSR 540

  Fly   536 RQTSSDGMIVH--KQEIPDMEDEAQ 558
            ..||...::.|  |...||::.:.|
  Rat   541 AYTSETYLMKHMRKHNPPDLQQQVQ 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 56/145 (39%)
C2H2 Zn finger 367..387 CDD:275368 6/19 (32%)
zf-H2C2_2 379..403 CDD:290200 9/23 (39%)
C2H2 Zn finger 395..415 CDD:275368 6/19 (32%)
zf-H2C2_2 407..432 CDD:290200 11/29 (38%)
C2H2 Zn finger 423..443 CDD:275368 6/19 (32%)
zf-H2C2_2 435..460 CDD:290200 12/24 (50%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
zf-H2C2_2 464..488 CDD:290200 14/25 (56%)
COG5048 475..>529 CDD:227381 21/56 (38%)
C2H2 Zn finger 479..499 CDD:275368 7/21 (33%)
zf-H2C2_2 491..515 CDD:290200 9/23 (39%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
Zfp384XP_038962888.1 C2H2 Zn finger 330..350 CDD:275368 0/19 (0%)
COG5048 <353..508 CDD:227381 61/154 (40%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..497 CDD:275368 7/21 (33%)
C2H2 Zn finger 505..525 CDD:275368 6/19 (32%)
C2H2 Zn finger 535..555 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.