| Sequence 1: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001154897.1 | Gene: | ZNF610 / 162963 | HGNCID: | 26687 | Length: | 462 | Species: | Homo sapiens |
| Alignment Length: | 264 | Identity: | 93/264 - (35%) |
|---|---|---|---|
| Similarity: | 128/264 - (48%) | Gaps: | 60/264 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 297 REASSGSGHHPVKKRNSQQMTKCQKCNGSGVVLVGQHSH-----ASHSGVGGSVKQSVTVKTECL 356
Fly 357 SCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTGEKPY 421
Fly 422 KCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGF------ARHATLWN-------------- 466
Fly 467 HRR--------IHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRH 523
Fly 524 RGIH 527 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 66/166 (40%) |
| C2H2 Zn finger | 367..387 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 379..403 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 395..415 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 407..432 | CDD:290200 | 15/24 (63%) | ||
| C2H2 Zn finger | 423..443 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 435..460 | CDD:290200 | 12/30 (40%) | ||
| C2H2 Zn finger | 451..471 | CDD:275368 | 9/47 (19%) | ||
| zf-H2C2_2 | 464..488 | CDD:290200 | 14/45 (31%) | ||
| COG5048 | 475..>529 | CDD:227381 | 25/53 (47%) | ||
| C2H2 Zn finger | 479..499 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 491..515 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 507..527 | CDD:275368 | 7/19 (37%) | ||
| ZNF610 | NP_001154897.1 | KRAB | 24..82 | CDD:214630 | |
| KRAB | 24..63 | CDD:279668 | |||
| C2H2 Zn finger | 206..226 | CDD:275368 | 3/13 (23%) | ||
| COG5048 | 217..>291 | CDD:227381 | 25/100 (25%) | ||
| zf-H2C2_2 | 218..243 | CDD:290200 | 7/30 (23%) | ||
| C2H2 Zn finger | 234..254 | CDD:275368 | 6/23 (26%) | ||
| zf-H2C2_2 | 246..271 | CDD:290200 | 8/45 (18%) | ||
| COG5048 | <257..446 | CDD:227381 | 76/188 (40%) | ||
| zf-C2H2 | 260..282 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 262..282 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 274..297 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 290..310 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 303..327 | CDD:290200 | 15/23 (65%) | ||
| zf-C2H2 | 316..338 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 318..338 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 330..354 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 346..366 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 358..382 | CDD:290200 | 3/23 (13%) | ||
| C2H2 Zn finger | 374..394 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 387..411 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 402..422 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 414..439 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 430..450 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||