DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and ZNF362

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001357141.1 Gene:ZNF362 / 149076 HGNCID:18079 Length:420 Species:Homo sapiens


Alignment Length:291 Identity:94/291 - (32%)
Similarity:133/291 - (45%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 TTPQAQAQLQQIVAAQT---GGTTPK--REASSGSGH---HPVKKRNSQQMTKCQKCNGSGVVLV 330
            :||...:|.:.|.::.|   |.|:|.  ....:..||   .|.|....::..|.:...|..|::|
Human   146 STPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVV 210

  Fly   331 GQHSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKC 395
            .....||    |.:.|:              .|.:.|.:|...|...|.:..|.|.|:..|.:||
Human   211 PYPILAS----GETAKE--------------GKTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHKC 257

  Fly   396 SICGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVC---GVCDKG 457
            ..|..:||.|.||..|.|||.|.|||.|..|...|.|..||:.|.|.|:|:|||.|   | |:|.
Human   258 PHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPG-CEKA 321

  Fly   458 FARHATLWNHRRIHTGEKPYKCEICGSAFSQAA----HLKNHAKVHSGEKPYKCEICSAAFADRF 518
            |.:.:.|.:|:|.|..:|||||..|..|:|.:|    ||..||..|:  |.|.|.:|..|:....
Human   322 FTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHLSAHAIKHA--KAYCCSMCGRAYTSET 384

  Fly   519 ALKRHRGIH----QKYGQTAPRQTSSDGMIV 545
            .|.:|...|    ......:|::|.|.|:.|
Human   385 YLMKHMSKHTVVEHLVSHHSPQRTESPGIPV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 60/145 (41%)
C2H2 Zn finger 367..387 CDD:275368 6/19 (32%)
zf-H2C2_2 379..403 CDD:290200 7/23 (30%)
C2H2 Zn finger 395..415 CDD:275368 9/19 (47%)
zf-H2C2_2 407..432 CDD:290200 13/24 (54%)
C2H2 Zn finger 423..443 CDD:275368 8/19 (42%)
zf-H2C2_2 435..460 CDD:290200 14/27 (52%)
C2H2 Zn finger 451..471 CDD:275368 8/22 (36%)
zf-H2C2_2 464..488 CDD:290200 11/23 (48%)
COG5048 475..>529 CDD:227381 22/61 (36%)
C2H2 Zn finger 479..499 CDD:275368 9/23 (39%)
zf-H2C2_2 491..515 CDD:290200 10/23 (43%)
C2H2 Zn finger 507..527 CDD:275368 5/19 (26%)
ZNF362NP_001357141.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PRK14971 <27..>125 CDD:237874
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..155 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202 5/23 (22%)
C2H2 Zn finger 229..249 CDD:275368 6/19 (32%)
zf-H2C2_2 241..266 CDD:372612 8/24 (33%)
zf-C2H2 255..277 CDD:333835 10/21 (48%)
C2H2 Zn finger 257..277 CDD:275368 9/19 (47%)
zf-H2C2_2 269..294 CDD:372612 13/24 (54%)
C2H2 Zn finger 285..305 CDD:275368 8/19 (42%)
SFP1 <307..359 CDD:227516 22/52 (42%)
C2H2 Zn finger 313..335 CDD:275368 8/22 (36%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 375..393 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.