DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and ZNF501

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001245209.1 Gene:ZNF501 / 115560 HGNCID:23717 Length:271 Species:Homo sapiens


Alignment Length:321 Identity:106/321 - (33%)
Similarity:147/321 - (45%) Gaps:77/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ESKASKCINCGSSMLQQSK-------RKGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQI 271
            :.|.|||..||....|:|.       .:|.|...|..|                           
Human    18 QKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSEC--------------------------- 55

  Fly   272 ISTTPQAQAQLQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQMTKCQKCNGSGVVLVGQHSHA 336
             .:..:.|:.|.|.:...|             |..|.|      ..:|:|...:..:|| ||...
Human    56 -GSCFRKQSNLTQHLRIHT-------------GEKPYK------CNECEKAFQTKAILV-QHLRI 99

  Fly   337 SHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSICGLA 401
             |:|                     .||:.||.||..|.:..||..|:::|:|||.|||:.||.|
Human   100 -HTG---------------------EKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECGKA 142

  Fly   402 FAKAVYLKNHARIHTGEKPYKCQTCGMQFSQSPHLKNHERTHSGERPYVCGVCDKGFARHATLWN 466
            |::::.|..|.|.|:|:||:||..||..|:||..|..|:|.||||:||.|..|.|.|.::::|..
Human   143 FSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVE 207

  Fly   467 HRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVHSGEKPYKCEICSAAFADRFALKRHRGIH 527
            |.|.|||||.|||..|...|.:.|||..|.::|:|||||:|..|..:|....||.||:.:|
Human   208 HERTHTGEKLYKCSECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 65/138 (47%)
C2H2 Zn finger 367..387 CDD:275368 8/19 (42%)
zf-H2C2_2 379..403 CDD:290200 13/23 (57%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
zf-H2C2_2 407..432 CDD:290200 12/24 (50%)
C2H2 Zn finger 423..443 CDD:275368 9/19 (47%)
zf-H2C2_2 435..460 CDD:290200 13/24 (54%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
zf-H2C2_2 464..488 CDD:290200 13/23 (57%)
COG5048 475..>529 CDD:227381 24/53 (45%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
zf-H2C2_2 491..515 CDD:290200 11/23 (48%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
ZNF501NP_001245209.1 COG5048 <20..256 CDD:227381 100/305 (33%)
C2H2 Zn finger 24..44 CDD:275368 5/19 (26%)
C2H2 Zn finger 52..72 CDD:275368 5/47 (11%)
zf-H2C2_2 64..87 CDD:290200 8/41 (20%)
C2H2 Zn finger 80..100 CDD:275368 6/21 (29%)
zf-H2C2_2 93..115 CDD:290200 12/44 (27%)
C2H2 Zn finger 108..128 CDD:275368 8/19 (42%)
zf-H2C2_2 120..145 CDD:290200 14/24 (58%)
C2H2 Zn finger 136..156 CDD:275368 8/19 (42%)
zf-H2C2_2 149..173 CDD:290200 12/23 (52%)
C2H2 Zn finger 164..184 CDD:275368 9/19 (47%)
zf-H2C2_2 177..201 CDD:290200 13/23 (57%)
C2H2 Zn finger 192..212 CDD:275368 7/19 (37%)
C2H2 Zn finger 220..240 CDD:275368 7/19 (37%)
zf-H2C2_2 232..257 CDD:290200 12/24 (50%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.