DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clamp and si:ch211-222k6.1

DIOPT Version :9

Sequence 1:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_021324960.1 Gene:si:ch211-222k6.1 / 100034531 ZFINID:ZDB-GENE-050208-649 Length:674 Species:Danio rerio


Alignment Length:516 Identity:131/516 - (25%)
Similarity:190/516 - (36%) Gaps:134/516 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TVDAQGRIQIVNQ--NKPIAANTISNISFKCDVCSDMFPHLALLNAHKRMHTDGEQQQQQQHNAQ 163
            |.|..|:..::.:  ||.:..:| ....|.||.|...|.|...|..|.::|| ||    :.|...
Zfish   115 TCDQCGKSFLLKERLNKHLKIHT-GEKPFTCDQCGKNFLHKGYLTEHIKIHT-GE----KPHTCD 173

  Fly   164 AGGDSIAVVSAQGLVQAQNIIGNGQM---------------GQIQIVSSDTLEPVQQSVMQQQQH 213
            ..|...|.   :|.:.....:..|:.               ..|:.|...|.|            
Zfish   174 QCGKRFAY---KGNLTDHMKVHTGERPYACDQCAKRFKHKGNLIEHVKIHTGE------------ 223

  Fly   214 ESKASKCINCGSS-----MLQQSKR--KGPKQVRCESCMQAEQTAQQQQQLFVAQDGQMAHPVQI 271
              :...|..||..     :|....|  .|.|...||.|.::....:.......:..|...|    
Zfish   224 --RPYSCDQCGKKFKLKHILSDHMRIHTGEKPFTCEKCGRSYTRKRNLSDHMKSHTGVKLH---- 282

  Fly   272 ISTTPQAQAQLQQIVAAQTGGTTPKREASSGSGHHPVKKRNSQQMTKCQKCNGS----GVVLVGQ 332
                          ...|.|    |....:|.....::..:.::...|.:|...    |.:.|.|
Zfish   283 --------------TCDQCG----KSFVKTGVFKVHLRTHSRERPFNCDQCGKDFLRMGTLKVHQ 329

  Fly   333 HSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSRYSSLWSHKKLHSGEKNYKCSI 397
               ..|||:                     |...|:.||..|.|.|.|..|:.:|:|||.:|||.
Zfish   330 ---KRHSGI---------------------KDHICSECGKTFFRDSELKVHQSVHTGEKPFKCSH 370

  Fly   398 CGLAFAKAVYLKNHARIHTGEKPYKCQTCGMQFSQ----SPHLKNHER----------------- 441
            |...|.:|.|:|.|.:||||||||:|:.||.:|..    :.|:|||.|                 
Zfish   371 CEKTFKRAEYMKMHRKIHTGEKPYECEKCGKKFRHKGNFNDHVKNHTRIKPFSCDQCGKCFRLKD 435

  Fly   442 -------THSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNHAKVH 499
                   .|:|..|:.|..|.|.|.:...|..|..|||||||:.||.||::|::..:|.:|..:|
Zfish   436 NFDDHMKVHTGGNPHTCAQCGKTFKQKHVLNEHLIIHTGEKPFTCEQCGTSFTRKRNLADHMTIH 500

  Fly   500 SGEKPYKCEICSAAFADRFALKRHRGIHQ-----KYGQTAPRQTSSDG----MIVHKQEIP 551
            :||..|.|:.|..:|.....||.|...|.     ...|...:...:|.    :.||.||.|
Zfish   501 TGENLYACDQCGRSFRQSRVLKEHLRTHSSERPFNCDQCGKKFFKADALKEHLTVHTQEKP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 62/166 (37%)
C2H2 Zn finger 367..387 CDD:275368 8/19 (42%)
zf-H2C2_2 379..403 CDD:290200 10/23 (43%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
zf-H2C2_2 407..432 CDD:290200 15/24 (63%)
C2H2 Zn finger 423..443 CDD:275368 9/47 (19%)
zf-H2C2_2 435..460 CDD:290200 12/48 (25%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
zf-H2C2_2 464..488 CDD:290200 14/23 (61%)
COG5048 475..>529 CDD:227381 20/58 (34%)
C2H2 Zn finger 479..499 CDD:275368 7/19 (37%)
zf-H2C2_2 491..515 CDD:290200 8/23 (35%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
si:ch211-222k6.1XP_021324960.1 C2H2 Zn finger 60..80 CDD:275368
C2H2 Zn finger 88..108 CDD:275368
C2H2 Zn finger 116..136 CDD:275368 4/19 (21%)
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
zf-H2C2_2 156..181 CDD:316026 8/29 (28%)
C2H2 Zn finger 172..192 CDD:275368 3/22 (14%)
COG5048 196..607 CDD:227381 108/426 (25%)
C2H2 Zn finger 200..220 CDD:275368 2/19 (11%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..276 CDD:275368 3/19 (16%)
C2H2 Zn finger 284..304 CDD:275368 4/23 (17%)
C2H2 Zn finger 312..332 CDD:275368 5/22 (23%)
C2H2 Zn finger 340..360 CDD:275368 8/19 (42%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 396..416 CDD:275368 6/19 (32%)
C2H2 Zn finger 424..444 CDD:275368 0/19 (0%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 6/19 (32%)
C2H2 Zn finger 536..556 CDD:275368 2/19 (11%)
C2H2 Zn finger 564..584 CDD:275368
C2H2 Zn finger 592..612 CDD:275368
C2H2 Zn finger 620..640 CDD:275368
C2H2 Zn finger 648..666 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.