DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Pla1a

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:306 Identity:89/306 - (29%)
Similarity:145/306 - (47%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMS-QSRGSFNRDVKNAYLKK 179
            |::.|.||....|.||:.|:...:  .|...|||||.|:::|||:.: .::.|:.....:|.|:.
Mouse    49 LKVQFLLFTPSDPSCGQLVEEGSD--IRSSEFNASLGTKVIIHGFRALGTKPSWIDKFISAVLRA 111

  Fly   180 GEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGS 244
            .:.|||.|||...|..: |:|.|:.:.....|:::|:..| .:.|....|:::||.||||.:.|.
Mouse   112 ADANVIAVDWVYGSTGV-YYSAVENVVKLSLEISRFLSKL-LELGVSESSIHIIGVSLGAHVGGM 174

  Fly   245 AGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNY 308
            .|...|. ::..|..||||||::.....|.|:|..||.:||::||.. |.|.|.|.|...::.|.
Mouse   175 VGHFYKG-QLGQITGLDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNG 238

  Fly   309 G-------AYQHSCY-YLGCSHIRSYQMFAESINSPLGFWGTPCIRDNGRWQCDYS--------- 356
            |       |:.|:.| ||.|.|:|:..::..::.:.......||        ..|.         
Mouse   239 GQDQPGCPAFFHAGYNYLICDHMRAVHLYISALENTCPLMAFPC--------ASYKAFLAGDCLD 295

  Fly   357 ---------------QRQSIQMAGEPSIHKEGIFYVKTSSSDPFAL 387
                           :|..:.:  || :.||...|:.|:||.|:.:
Mouse   296 CFNPFLLSCPRIGLVERGGVMI--EP-LPKEVKVYLLTTSSAPYCV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 86/298 (29%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5841
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.