DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG34447

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:133/287 - (46%) Gaps:30/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FYLFK---REFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGE 181
            |:|:.   ||.|.....:|.:   .|   .|....|.:::|||:......:.|..::...|...:
  Fly    44 FWLYSNSTRENPILLDPLDLN---PW---NFQPPRPLKILIHGYTGDRDFAPNSYIRPVLLDHED 102

  Fly   182 YNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNL-NRQFGADFDSMYLIGHSLGAQIAGSA 245
            ..||.:|:........|...|:.:......|||.|.|| :|...|: |.::|||.|||.|:||..
  Fly   103 VYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLINNLVDRAIVAN-DQIHLIGFSLGGQVAGQT 166

  Fly   246 GKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYG 309
            ...:|. |:..|..||||.|.|.......|:|..||.:|:.:||.. ..|:.|..|...||||:|
  Fly   167 ANYVKR-KMKRITGLDPAKPLFILGPDSRRLDKGDADFVDVIHTDVFGRGYLRAAGHVDFYPNFG 230

  Fly   310 AYQHSCYY------LGCSHIRSYQMFAESINSPLGFWGTPCIRDNGRW------QCDYSQRQSIQ 362
            |.|..|..      ..|:|.|:.:.:|||||:.:|||...|    ..|      .|..:..|:: 
  Fly   231 AKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGFWARQC----SGWLLQLLTLCPTTGAQAL- 290

  Fly   363 MAGEPSIHKEGIFYVKTSSSDPFALGK 389
            :....|....|.::::|:|..|:||||
  Fly   291 LGYHVSDELRGSYFLQTASKSPYALGK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 82/277 (30%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 82/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.