DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and PNLIP

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:275 Identity:85/275 - (30%)
Similarity:121/275 - (44%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PFGSKKLRMHFYLFKREFPECGREV----------DFSIERKWRHCGFNASLPTRLMIHGWMSQS 164
            |:..|.:...|.|:..|.|...:||          :|...||           ||.:|||::.:.
Human    45 PWSPKDVNTRFLLYTNENPNNFQEVAADSSSISGSNFKTNRK-----------TRFIIHGFIDKG 98

  Fly   165 RGSFNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDS 229
            ..::..:|.....|....|.|.|||...| ...|....:.|...|||:|.|:..|...||....:
Human    99 EENWLANVCKNLFKVESVNCICVDWKGGS-RTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSN 162

  Fly   230 MYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHT----- 289
            :::|||||||..||.||:|.... :..|..||||.|.|:......|:||||||:|:.:||     
Human   163 VHVIGHSLGAHAAGEAGRRTNGT-IGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPI 226

  Fly   290 --SANFGFRRPTGSATFYPNYGAYQHSCY-------------------YLGCSHIRSYQMFAESI 333
              :..||..:..|...|:||.|.....|.                   :..|:|:|||:.:.:||
Human   227 VPNLGFGMSQVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSI 291

  Fly   334 NSPLGFWGTPCIRDN 348
            .:|.||.|.||...|
Human   292 VNPDGFAGFPCASYN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 83/269 (31%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 85/275 (31%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5841
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.