DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and PLA1A

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:311 Identity:95/311 - (30%)
Similarity:146/311 - (46%) Gaps:46/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NPFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHG---------WMSQS 164
            |.|....|::.|.||....|.||:.|:.|.:  .::.||||:|.|:|:|||         |:.  
Human    42 NLFEGTDLKVQFLLFVPSNPSCGQLVEGSSD--LQNSGFNATLGTKLIIHGFRVLGTKPSWID-- 102

  Fly   165 RGSFNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDS 229
              :|.|.:    |:....|||.|||...|..: |||.||.:.....|::.|:..| ...|....|
Human   103 --TFIRTL----LRATNANVIAVDWIYGSTGV-YFSAVKNVIKLSLEISLFLNKL-LVLGVSESS 159

  Fly   230 MYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA-NF 293
            :::||.||||.:.|..| :|...::..|..||||||::.....|.|:|..||.:||::||.. |.
Human   160 IHIIGVSLGAHVGGMVG-QLFGGQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNL 223

  Fly   294 GFRRPTGSATFYPNYGAYQHSC---YYLG-----CSHIRSYQMFAESINSPLGFWGTPCIRDN-- 348
            |.|.|.|...::.|.|..|..|   :|.|     |.|:|:..::..::.:.......||....  
Human   224 GIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAF 288

  Fly   349 --GR-------WQCDYSQRQSIQMAG---EPSIHKEGIFYVKTSSSDPFAL 387
              ||       :.....:...::..|   || :.||...|:.|:||.|:.:
Human   289 LAGRCLDCFNPFLLSCPRIGLVEQGGVKIEP-LPKEVKVYLLTTSSAPYCM 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 90/296 (30%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 94/307 (31%)
Pancreat_lipase_like 49..332 CDD:238363 90/296 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5841
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.