DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG6277

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:411 Identity:122/411 - (29%)
Similarity:187/411 - (45%) Gaps:96/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTHLFALCLSMATIGIP-----KANGVMDDYDAEMGEFMNALPNLDDTPYGLGQRSDISTEPEE 60
            |:|.|.....::|...||     :.:|       |.|.::                      |:|
  Fly     1 MKTFLILAFFALAASAIPIKESERVHG-------ENGWYV----------------------PQE 36

  Fly    61 DDILASLDDEYEEAKHCVWNTCDKDLSESRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYLFKR 125
            |.....:|.:..|.    |... ::|.||||:                     ..:.:.|||:..
  Fly    37 DGTSEWVDMDVAEQ----WMEA-QELLESRGL---------------------TTVPVKFYLYTS 75

  Fly   126 EFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNVIVVDWS 190
            ..|..|:::..| .:......||::.|||.:||||......|.|:|:::|:|.:|:|||||||| 
  Fly    76 SNPTKGKKITAS-TKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDYNVIVVDW- 138

  Fly   191 ASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVN 255
            |.:.:::|.:.|..:...|.::|:.|..|....|.:.:.:|:|||||||.:||.|||.... :|:
  Fly   139 ARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVAGYAGKNTDG-QVH 202

  Fly   256 TIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNYGAYQHSCYYLG 319
            ||..||||.|.|.:.....|::..||.||||:.|: ...||.:|.|...||||.|..|..|   |
  Fly   203 TIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQPGC---G 264

  Fly   320 ------CSHIRSYQMFAESINSPLGFWGTPCIRDN-GRWQC-DY---------SQRQSIQMAGEP 367
                  |||.||...:||:::           .|| |..:| ||         |...|::|..:.
  Fly   265 LDLTGACSHGRSTTYYAEAVS-----------EDNFGTMKCGDYEEAVSKECGSTYSSVRMGADT 318

  Fly   368 SIHK-EGIFYVKTSSSDPFAL 387
            :.:. ||.:||..:|..||.:
  Fly   319 NAYMVEGDYYVPVNSKAPFGM 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 99/283 (35%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 99/281 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438418
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D81025at33392
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.