DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG6295

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:352 Identity:109/352 - (30%)
Similarity:159/352 - (45%) Gaps:66/352 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PEEDDILASLDDEYEEAKHCVWNTCDKDLSESRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYL 122
            |:.|..:..:|.|:.||   ...|  |:..|.|.:               |||       :.|||
  Fly    31 PQADGTMEWMDREFAEA---YLET--KNRMEGRNV---------------LNP-------VTFYL 68

  Fly   123 F---KREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNV 184
            :   .|..|:..:....||...  |  ||.:.|||..||||.|......|..|::|:...|:.|:
  Fly    69 YTNSNRNSPQEIKATSASISGS--H--FNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNM 129

  Fly   185 IVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRL 249
            |.||| ..:.:::|.|.|..:...|.::|..|..:....|.:.|:..:|||||||.::|.|||.:
  Fly   130 IAVDW-GRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNV 193

  Fly   250 KPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNYGAYQH 313
            |..:::||..||||.|.|.:.....|:..:||.||||:.|: ...||.:|.|...||||.|..|.
  Fly   194 KNGQLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQP 258

  Fly   314 SCYYLG------CSHIRSYQMFAESINSPLGFWGTPCIRDNGRWQC-DY---------SQRQSIQ 362
            .|   |      |:|.||...:|||:...    ..|.:|      | ||         |...|::
  Fly   259 GC---GVDLTGSCAHSRSVIYYAESVTEN----NFPTMR------CGDYEEAVAKECGSSYSSVR 310

  Fly   363 MAGEPSIHK-EGIFYVKTSSSDPFALG 388
            |....:.:. .|.:||...|..|:.:|
  Fly   311 MGATTNAYMVAGDYYVPVRSDAPYGMG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 93/285 (33%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 93/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D81025at33392
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.