DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG4582

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:144/269 - (53%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 RKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAY--LKKGEYNVIVVDWSASSANINYFSVV 202
            |:.|...||   |||::||||:.....:...::..||  |:.|.||:..||| ...|..:|.:..
  Fly   155 RRSRFSPFN---PTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDW-GRGAIADYITAS 215

  Fly   203 KLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKF 267
            ..::..|..||:|:..|:::.|..|:.:.|:|.|:||.:||.|||.|:..::..|.|||||.|.|
  Fly   216 YRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFF 280

  Fly   268 RHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNYGAYQHSCYYLGCSHIRSYQMFAE 331
            |:...:.|:...||.|||.:||| .::||.||.|...||.|:|:.|..|::..|||.|::.:|||
  Fly   281 RYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHECSHWRAFMLFAE 345

  Fly   332 SI--NSPLGFWGTPCIRDNGRWQ-------C--DYSQRQSI-----QMAGEPSIHKEGIFYVKTS 380
            |:  :...||....|  ....||       |  |....|::     .::.|....::|::|.:|:
  Fly   346 SLARDQATGFLSQGC--PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTN 408

  Fly   381 SSDPFALGK 389
            ...|:.|.:
  Fly   409 DQPPYVLAQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 89/259 (34%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D81025at33392
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.