DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and sxe2

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:300 Identity:102/300 - (34%)
Similarity:151/300 - (50%) Gaps:28/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PFGSKKLRMHFYL-FKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVK 173
            |..:|.||...|. ...|..:..|..|.::   .|:..||...|.|:.||||..:|....|..:|
  Fly    65 PSQTKLLRYDLYTPLNPEERQLLRPGDLTM---LRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIK 126

  Fly   174 NAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLG 238
            :|||.:|.||||::|||..|.:|:|..|.|.:.:..|.:|:.:|.|:...|..::.:|:||||.|
  Fly   127 DAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAG 191

  Fly   239 AQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSANFGFRRPT---G 300
            :.|:|..||.|:|.::..||||||||......|.|.|:|.:||.||||:||.... ...|:   .
  Fly   192 SHISGLTGKLLRPHRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTL-LGNPSTKLS 255

  Fly   301 SATFYPNYGAYQHSC-------YYLGCSHIRSYQMFAESINSPLGFWGTPCIRD----NGRWQCD 354
            .|:|:.|:|..|..|       :...|.|..:...||||:..|..|....|...    :....|:
  Fly   256 HASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCN 320

  Fly   355 Y--SQRQSIQ-------MAGEPSIHKEGIFYVKTSSSDPF 385
            .  |::.::.       |.|||::.|.||||:.|....|:
  Fly   321 VGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 99/288 (34%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 101/298 (34%)
Pancreat_lipase_like 72..356 CDD:238363 98/287 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.