| Sequence 1: | NP_610132.3 | Gene: | CG6675 / 35439 | FlyBaseID: | FBgn0032973 | Length: | 390 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_000228.1 | Gene: | LPL / 4023 | HGNCID: | 6677 | Length: | 475 | Species: | Homo sapiens |
| Alignment Length: | 217 | Identity: | 75/217 - (34%) |
|---|---|---|---|
| Similarity: | 106/217 - (48%) | Gaps: | 32/217 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 145 CGFNASLPTRLMIHGWMSQSRGSFN----RDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLI 205
Fly 206 ETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHR 270
Fly 271 GTEFRIDPSDAKYVESMHT------SANFGFRRPTGSATFYPNYGAYQHSCYY-----------L 318
Fly 319 G-------CSHIRSYQMFAESI 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6675 | NP_610132.3 | Pancreat_lipase_like | 116..381 | CDD:238363 | 75/217 (35%) |
| LPL | NP_000228.1 | Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 | 32..53 | ||
| Lipase | 33..473 | CDD:332983 | 75/217 (35%) | ||
| Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 | 243..266 | 3/22 (14%) | |||
| Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 | 417..421 | ||||
| Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 | 430..434 | ||||
| Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 | 443..467 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165145314 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11610 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||