DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and LIPC

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:348 Identity:96/348 - (27%)
Similarity:148/348 - (42%) Gaps:83/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IKKIASNLNPFGSK-----------KLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTR 154
            ::|...:..|||.:           :::..|.||......|  ::..:.....:.||||:|||..
Human    34 MRKAPVSEEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGC--QIRINHPDTLQECGFNSSLPLV 96

  Fly   155 LMIHGWMSQSRGSFNRDVKN------AYLKK---GEYNVIVVDWSASSANINYFSVVKLIETFGA 210
            ::||||      |.:..::|      |.||.   ...||.:||| .:.|:.:|...|:.....|.
Human    97 MIIHGW------SVDGVLENWIWQMVAALKSQPAQPVNVGLVDW-ITLAHDHYTIAVRNTRLVGK 154

  Fly   211 ELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPV-KVNTIFALDPAGPKFRHRGTEF 274
            |:|..:|.|..........::|||:||||.::|.||..:... |:..|..||.|||.|.......
Human   155 EVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSN 219

  Fly   275 RIDPSDAKYVESMHT------SANFGFRRPTGSATFYPNYGAYQHSCYYL--------------- 318
            |:.|.||.:|:::||      ..:.|.::|.|...||||.|::|..|::|               
Human   220 RLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAIT 284

  Fly   319 ---GCSHIRSYQMFAESINSPLGFWGT-----PCIRDNG----------RWQCD---YSQRQSIQ 362
               .|||.||..:|.:|:...    ||     ||...|.          :.:|:   |..||   
Human   285 QTIKCSHERSVHLFIDSLLHA----GTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQ--- 342

  Fly   363 MAGEPSIHKEGIFYVKTSSSDPF 385
               ||....:.:|.| |.:..||
Human   343 ---EPRSKSKRLFLV-TRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 90/316 (28%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.