DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG10116

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:278 Identity:75/278 - (26%)
Similarity:130/278 - (46%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNV 184
            |:|..|...|..:.::..:|...| ..|.|:.||.:.|..|:..........|.:|.|::.:.|:
  Fly    24 FFLNTRRVQENAQPIEAEVEALVR-SSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNI 87

  Fly   185 IVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRL 249
            |.||  .|.||    ...::|::    :|..:..|:.||....|.:.::|.:.||.:||....::
  Fly    88 ISVD--LSEAN----DETEIIDS----VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKV 142

  Fly   250 KP---VKVNTIFALDP-AGPKFRHRGTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYG 309
            :.   .:::.|.|||| :|.:..|     ::..:||::||.:||:| ..|.....|...:|||.|
  Fly   143 QQDLGRQLSQITALDPSSGAELDH-----KLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGG 202

  Fly   310 AYQHSCYYLGCSHIRSYQMFAESINSPLGFWGTPC--IRDNGRWQCDYSQRQSIQMAGE--PSIH 370
            ..|..|....|||.|::::.||..:....|....|  :.......|.:|..:..|...|  |:  
  Fly   203 QTQPGCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPA-- 265

  Fly   371 KEGIFYVKTSSSDPFALG 388
             .||::::|..|.||:.|
  Fly   266 -SGIYFLETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 71/269 (26%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.