DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and lipca

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:285 Identity:80/285 - (28%)
Similarity:125/285 - (43%) Gaps:48/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CGFNASLPTRLMIHGWMSQSRGSFNRDVKN--AYLK--KGEYNVIVVDWSASSANINYFSVVKLI 205
            ||||:|||..::||||...  |...:.:..  :.||  :|..||::.|| .:.|:.:|....:..
Zfish    72 CGFNSSLPLAIIIHGWSVD--GMMEKWISRLASALKSSEGNINVLIADW-LTLAHQHYPIAAQNT 133

  Fly   206 ETFGAELAQFIRNLN--RQFGADFDSMYLIGHSLGAQIAGSAGKRL--KPVKVNTIFALDPAGPK 266
            ...|.::|..:..|.  :||  ....::|||:||||.|:|.||..|  ....:..|..||||||.
Zfish   134 RIVGQDIAHLLSWLEDFKQF--PLGKVHLIGYSLGAHISGFAGSNLAMSGRTLGRITGLDPAGPM 196

  Fly   267 FRHRGTEFRIDPSDAKYVESMHT------SANFGFRRPTGSATFYPNYGAYQHSCYY-------- 317
            |.......|:.|.|||:|:::||      ..:.|.::|.....||||.|::|..|..        
Zfish   197 FEGMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGGSFQPGCQLHMQNIYAH 261

  Fly   318 ------------LGCSHIRSYQMFAES-INSPLGFWGTPCIRDN---GRWQCDYSQRQSIQMAG- 365
                        :.|:|.|:..:|.:| :|.........| .||   .:..|...::......| 
Zfish   262 LAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKC-SDNTAFDKGNCLDCRKNRCNTLGY 325

  Fly   366 ---EPSIHKEGIFYVKTSSSDPFAL 387
               :....|....::||.|..|:.|
Zfish   326 DIKKVRTGKSKRLFLKTRSHMPYKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 77/277 (28%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 80/285 (28%)
Pancreat_lipase_like 54..344 CDD:238363 77/277 (28%)
PLAT_LPL 351..485 CDD:238856 80/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.