DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and lipg

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:292 Identity:81/292 - (27%)
Similarity:123/292 - (42%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CGFNASLPTRLMIHGW-MSQSRGSF----NRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKL 204
            |||||:|.|.|:|||| ||   |.|    ::.|.....::.|.||:|||| ...||..|...|..
Zfish    81 CGFNATLRTILIIHGWTMS---GMFESWMHKLVAAVQRRESEANVVVVDW-LGLANQLYPDAVNH 141

  Fly   205 IETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRH 269
            ....|..:|..:..|..:.....:::::||:||||.:||.||..:..: :..|..||||||.|..
Zfish   142 TRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGTFVNGI-IGRITGLDPAGPMFEG 205

  Fly   270 RGTEFRIDPSDAKYVESMHT------SANFGFRRPTGSATFYPNYGAYQHSCYY----------- 317
            ..:..::.|.||.:|:.:||      ..:.|.:.|.|....|||.|..|..|.:           
Zfish   206 ADSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNF 270

  Fly   318 ---LGCSHIRSYQMFAESINSPLGFWGTPCIRDNGRWQCDYSQRQSIQMAGEPSIHKEGI----- 374
               :.|.|.|:..:|.:|:.:          :|:..:        :.|..| |...|:||     
Zfish   271 MEAMKCEHERAVHLFVDSLMN----------KDHVSY--------AFQCTG-PDRFKKGICLSCR 316

  Fly   375 ---------------------FYVKTSSSDPF 385
                                 .|:||.:..||
Zfish   317 KNRCNSIGYNAKKMRKRRNSKMYLKTRADTPF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 79/286 (28%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 81/292 (28%)
Pancreat_lipase_like 65..344 CDD:238363 79/286 (28%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.