DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG10357

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:127/267 - (47%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RLMIHGWM-SQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIR 217
            :|::||:: |.:.||. ..::|||..:|..||:|.|| ...||::|.|....::.....||:.:.
  Fly    56 KLIVHGYLGSCTHGSI-MPLRNAYTAQGYENVLVADW-GPVANLDYPSSRLAVKNVAQILAKLLE 118

  Fly   218 NLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAK 282
            ...::.|...:.:::|||||||.|||..|:.... .:..:..||||.|.|..|..: .:..:.|:
  Fly   119 EFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNG-SLGRVTGLDPALPLFSSRSDD-SLHSNAAQ 181

  Fly   283 YVESMHTS-ANFGFRRPTGSATFYPNYG-AYQHSCYYL-------------GCSHIRSYQMFAES 332
            :|:.:||. ..||..||.|:..||||:| |.|..|..:             .|||.|:...:|||
  Fly   182 FVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAES 246

  Fly   333 INSPLGFWGT-------------PCIRDNGRWQCDYSQRQSIQMAGEPSIHKEG--IFYVKTSSS 382
            |..|..|...             .|:|:..:...:.:........|| .:::..  .:|::|:.:
  Fly   247 IGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGE-HVNRSATLYYYLETNGA 310

  Fly   383 DPFALGK 389
            .|:..|:
  Fly   311 PPYGQGR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 73/257 (28%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.