DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG13562

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:269 Identity:65/269 - (24%)
Similarity:107/269 - (39%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LMIHGWMSQSRGSFNRDV--KNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIR 217
            :::|||:......:...:  :.:|.:.|  .||.:|:|. .|:.:|..:....:|....::..|.
  Fly    97 IVLHGWIQSCSDEWALSLIERLSYYRGG--CVICIDYSV-VASSSYMRLYTNFDTLTGAISSIIL 158

  Fly   218 NLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVK-VNTIFALDPAGPKFRHRGTEFRIDPSDA 281
            .|.|| |.|....|:.|.|.|.|:|.:.|:.|:|.. :.:|...|.|||.|    ....:|.|.|
  Fly   159 TLFRQ-GFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGF----DPIAVDHSKA 218

  Fly   282 -KYVESMHTSANFGFRRPTGSATFYPNYGAYQHSCY---YLG-CS----------HIRS------ 325
             |:|:..|:|.               :.|.:.:||:   .|| |.          |:.|      
  Fly   219 GKHVQCFHSSR---------------DKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVD 268

  Fly   326 -------YQMFAESINSPLGF-W-GTPCIRDNGRWQCDYSQRQSIQMAGEPSIHKEGIFYVKTSS 381
                   |..:|.:...|..| | .|..|.|.  :...|.:....|:.|:        .:|.||.
  Fly   269 IYINTFDYPFYAVNYTPPECFTWQKTAKIPDG--YTVGYEENFDSQVTGQ--------IFVPTSL 323

  Fly   382 SDPFALGKQ 390
            ..|:.|.|:
  Fly   324 HYPYNLSKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 61/258 (24%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/114 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.