DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG13282

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:376 Identity:113/376 - (30%)
Similarity:151/376 - (40%) Gaps:87/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NALPNLDDTPYGLGQRSDISTEPEEDDILASLDDEYEEAKHCVWNTCDKDLSESRGIGKFLDLPF 100
            |..|....||    ...||:..|                  |.|           .||:....|.
  Fly    45 NPTPTSTTTP----SNRDITIGP------------------CKW-----------AIGRSCPDPD 76

  Fly   101 IKKIASNLNPFGSKKLRMHFYLFKREFP---ECGREVDFSIER-KWRHCGFNASLPTRLMIHGWM 161
            :|                 :|::.|..|   :| ..:|.|:|: ......||...||:::|||:.
  Fly    77 VK-----------------YYIYTRHNPMDRQC-LHIDESLEKSNLTDSYFNPRYPTKIIIHGYN 123

  Fly   162 SQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGAD 226
            |.......:.::..||.|.:||:|.||||..|....|.|.|...:..|...||.:..|......|
  Fly   124 SDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNTD 188

  Fly   227 FDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA 291
               :::||.|||||:.....:.|....:..|..||||.|.|...|...::|||||.||:.:||:|
  Fly   189 ---IHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNA 250

  Fly   292 NF-GFRRPTGSATFYPNYGAYQHSC-----YYLGCSHIRSYQMFAESINSPLGFWGTPCIRDNGR 350
            .. |.....|.|.||.|.|..|..|     ....|||.|:...|.|||.||.||||         
  Fly   251 LVQGKMERCGHADFYMNGGIMQPGCNGQKINSFACSHQRAPAYFLESIRSPKGFWG--------- 306

  Fly   351 WQCDYSQRQSIQM---------AGE---PSIHKEGIFYVKTSSSDPFALGK 389
            |.|.......:.|         |||   |:  ..|:|.:.|:.|.||||||
  Fly   307 WACSGYISYLLGMCPPTNFLLEAGENIRPT--TRGMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 93/286 (33%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 98/315 (31%)
Pancreat_lipase_like 75..347 CDD:238363 95/303 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445957
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.