DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG6431

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:373 Identity:93/373 - (24%)
Similarity:139/373 - (37%) Gaps:88/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTHLFALCLSMATIGIPKANGVMDDYDAEMGEFMNALPNLDDTPYGLGQRSDISTEPEEDDILA 65
            |.|.|.||.||:.::. |..|.  ..|..|..:|:....|.|..|.                   
  Fly     4 MLTSLIALLLSLLSLN-PITNA--SKYHREALQFLLRNGNFDLNPL------------------- 46

  Fly    66 SLDDEYEEAKHC---VWNTCDKDLSESRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYLFKREF 127
                      :|   :|.||.|         :|:|                      :.||....
  Fly    47 ----------NCHILLWETCPK---------RFID----------------------YQLFTSNG 70

  Fly   128 PECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNVIVVDWSAS 192
            |..|..::..........||:....|..:|||:...:.....:.:::|||.: ::|||.|||...
  Fly    71 PRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYLSR-DFNVITVDWRPL 134

  Fly   193 SANINYF-SVV--KLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKV 254
            :....|. |::  :|.....|::..|:.:    :||..:.:..:||||||.|.|.....|.. |.
  Fly   135 TRYPCYLHSLINTRLTAQCTAQIYAFLTH----YGAVRERITCVGHSLGAHICGMISNHLTR-KQ 194

  Fly   255 NTIFALDPAGPKF-RHRGTEFRIDPSDAKYVESMHTSANF-GFRRPTGSATFYPNYGAYQHSCYY 317
            ..|..||||.|.. |.:..:||:...||..::.:||:|.| |....:|...:..|.|..|..|  
  Fly   195 YRIIGLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFC-- 257

  Fly   318 LG-------CSHIRSYQMFAESINSPLGFWGTPCIRDNGRWQCDYSQR 358
            .|       |||..|....|.:......|.|.||  .||......|:|
  Fly   258 KGNPIRKSRCSHFLSICYLATATFKHNKFMGVPC--PNGCLNLSGSKR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 71/255 (28%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.