DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG17292

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:271 Identity:89/271 - (32%)
Similarity:137/271 - (50%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSANINY-FSVVKLIETFGAELAQFI 216
            |.|.:||::..........:..|||::.:.|:||:|| ...|:.|| |.....::..|.|||:.:
  Fly    61 TVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDW-GELADGNYMFDAFPNLKQLGPELAKVL 124

  Fly   217 RNLNRQFGADFDSMYLIGHSLGAQIAGSAG----KRLKPV-KVNTIFALDPAGPKFRHRGTEFRI 276
            ..: ...|.|.:..:::|||:|.|:||..|    ||.|.| |:..|.|||||.|.| :.||  .:
  Fly   125 LKM-FDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF-YPGT--HL 185

  Fly   277 DPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYGAYQHSCYYL--GC--------------SHIR 324
            ..:||::|:.:||.| .:|....||:|.|:||.|      |.|  ||              ||.|
  Fly   186 SANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGG------YSLQPGCPKRNYKMLSDNDLSSHRR 244

  Fly   325 SYQMFAESINS--PLGFWGTPCIRDNGRWQCDYSQRQSIQ-----MAGE---PSIHKEGIFYVKT 379
            |:..:|||::.  |:||...|.    .:|. |:.|.:.::     :.|.   .:||  |.||::|
  Fly   245 SWWFWAESVSDRYPIGFDAVPA----KKWS-DFKQNKIVENCPPVVMGHHCPTTIH--GDFYLQT 302

  Fly   380 SSSDPFALGKQ 390
            :...|||.||:
  Fly   303 NGHTPFARGKE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 84/260 (32%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 83/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.