DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG14034

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:308 Identity:85/308 - (27%)
Similarity:139/308 - (45%) Gaps:47/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KIASNLNPFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGS 167
            :|..|.|        :.|:|:.:|..|..:...|.:.|    ..|....|.:::|||:......|
  Fly    31 EICPNAN--------ISFWLYTKENQEGTKLSVFELNR----FEFYHHKPLKVLIHGFNGHRDFS 83

  Fly   168 FNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYL 232
            .|..::..:|.: :||:|.:|:...:....|...|...:......||.:|.|........:.::|
  Fly    84 PNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHL 147

  Fly   233 IGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSAN-FGFR 296
            ||..|||.:||..|:.|...|:..|.|||||.|.:..:....::||:|||:|:.:||... .|..
  Fly   148 IGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLL 212

  Fly   297 RPTGSATFYPNYGAYQHSCYYLG------CSHIRSYQMFAESINSPLGFWG--TP---------C 344
            ...|...||.|.|..|.:|..:.      |.|.|:...:||||:||.||:|  .|         |
  Fly   213 DAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC 277

  Fly   345 IRDNGRWQCDYSQRQSIQMAG---EPSIHKEGIFYVKTSSSDPFALGK 389
            |.|           ::|::.|   :|.  ..|.:::.|::..|:|.|:
  Fly   278 IPD-----------KNIELMGFHVDPK--ARGRYFLDTNNGPPYAKGE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 79/285 (28%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 79/291 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.