DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG4267

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:321 Identity:166/321 - (51%)
Similarity:211/321 - (65%) Gaps:16/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TCDKDLSESRGIGKFLDLPFIKKIASNLNPFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHC 145
            ||:..|.:.:.:|  :|..|.||...:|.||.|.:.:|.|.||||:|.:||||:........|:.
  Fly    37 TCNYTLVKKKTLG--VDPSFWKKFFKHLIPFTSSRGKMQFILFKRDFADCGRELFVGDVENLRNS 99

  Fly   146 GFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLK------KGE------YNVIVVDWSASSANINY 198
            ||:|...||::||||||||:||..|.||||||.      .||      :||||.|||.:|.|:||
  Fly   100 GFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNY 164

  Fly   199 FSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPA 263
            :.|.|.:|..||.||:.:|.||::....:|.:|:|||||||||||||||::.|.:.|||:|||||
  Fly   165 YEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFNTIYALDPA 229

  Fly   264 GPKFRHRGTEFRIDPSDAKYVESMHTSANFGFRRPTGSATFYPNYGAYQHSCYYLGCSHIRSYQM 328
            ||:||.:..|:|||.|||.||||:.||.:|||.:|.|.||||||||..|..||..||||.||:..
  Fly   230 GPQFREKSDEYRIDASDASYVESIQTSVSFGFEQPVGHATFYPNYGKNQKKCYVYGCSHKRSHDY 294

  Fly   329 FAESINSPLGFWGTPCIR-DNGRWQCDYSQRQSIQMAGEPSIHKEGIFYVKTSSSDPFALG 388
            |.||:.||.||||..|.| |:|.|....|..: .:|.|||||.|.|.|||||.|..|:|:|
  Fly   295 FIESLTSPAGFWGPRCERHDDGTWLLLMSDGE-FRMGGEPSIPKNGTFYVKTYSKPPYAMG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 150/277 (54%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 154/287 (54%)
Pancreat_lipase_like 71..347 CDD:238363 150/276 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.