DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Lipi

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi / 320355 MGIID:2443868 Length:485 Species:Mus musculus


Alignment Length:344 Identity:95/344 - (27%)
Similarity:154/344 - (44%) Gaps:60/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SESRGIGKFLD-----LPFIKKIASN-LNPFGSKKLRMHFYLFKREFPECGR---EVDFSIERKW 142
            |.:.|:.|..:     |.|.|..|.| |......|::::..::.|...:|..   |.:.|:..: 
Mouse    22 SNTTGVSKDPEKKRTCLEFTKLSAMNSLKDLFCPKVKINLLMYSRGNAKCAEPLFESNNSLNTR- 85

  Fly   143 RHCGFNASLPTRLMIHG---------WMSQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSANINY 198
                ||.:..|..:|||         |:|:    |.:    |:||:.:.|:|||||:..:....|
Mouse    86 ----FNPAKKTVWIIHGYRPFGSTPVWLSR----FTK----AFLKQEDVNLIVVDWNQGATTFMY 138

  Fly   199 FSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPA 263
            ...|:........|.:.|.|| ...||..|:.:.||.||||.|:|..|| :...::..|..||||
Mouse   139 SRAVRNTRRVAEILRETIENL-LIHGASLDNFHFIGMSLGAHISGFVGK-IFHGQLGRITGLDPA 201

  Fly   264 GPKFRHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATFYPNYGAYQHSC--------YYLG 319
            ||:|..:.:..|:..:|||:|:.:||. .:.|...|:|...||||.|.:|..|        .::.
Mouse   202 GPQFSRKPSNSRLYYTDAKFVDVIHTDIKSLGIGEPSGHIDFYPNGGKHQPGCPTSIFSGTNFIK 266

  Fly   320 CSHIRSYQMFAESINSPLGFWGTPC--IRD--NGRW-QCDYSQRQSI-QMAGEPSIHKEGI---- 374
            |.|.|:..:|..:..:...|...||  .:|  ||.. .|....:.|. ::..:..:.||.:    
Mouse   267 CDHQRAIYLFLAAFETSCNFVSFPCRSYKDYKNGLCVDCGNLYKDSCPRLGNQAKLWKEELKKKT 331

  Fly   375 --------FYVKTSSSDPF 385
                    .::.|||.:||
Mouse   332 EEWPLRTTAFLDTSSQNPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 81/303 (27%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 81/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.