DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and CG1986

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:305 Identity:93/305 - (30%)
Similarity:133/305 - (43%) Gaps:58/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EC--------GREVDFSIE----RKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAY-LKKG 180
            ||        |.||.|:::    |.:|....|..|  .|.:|||..|....:.:::...: |...
  Fly    61 ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKL--ALFLHGWNDQGSKDWVQELLLTWTLFDS 123

  Fly   181 EYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADF--DSMYLIGHSLGAQIAG 243
            .|||.||||...|.| :|.|....|...|..:|..|..|.......|  .::.|.|:||||..||
  Fly   124 NYNVCVVDWGNLSQN-DYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAG 187

  Fly   244 SAGKRLKPVKVNTIFALDPAGPKF---RHRGTEFRIDPSDAKYVESMHTS-ANFGFRRPTGSATF 304
            .||..|:. :|..|..||||||.|   .....::|:||.||::|:.:||| .:.|.....|.|.|
  Fly   188 YAGAVLEG-QVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADF 251

  Fly   305 YPNYG-AYQHSCYY------------LGCSHIRSYQMFAESINSPLGFWGTPC--IRDNGRWQCD 354
            |||.| |.|.:|..            :.|||..:...|.:|::....|.|..|  .|:.....||
  Fly   252 YPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCD 316

  Fly   355 ---------YSQRQSIQMAGEPSIHKEGIFYVKTSSSDPFALGKQ 390
                     :|||::           :|.||.:|:...|:...:|
  Fly   317 GNRKARFGIHSQRRA-----------QGSFYFRTAPQQPYVPRRQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 91/294 (31%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 89/288 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.