DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Lipg

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:349 Identity:90/349 - (25%)
Similarity:133/349 - (38%) Gaps:94/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SNLNPFGSKKLRMH----------------FYLFKREFPEC-GREVDFSIERKWRHCGFNASLPT 153
            :.|.|.||.:...|                |.:...:.||. |..:.....:...:||||.:..|
  Rat    23 TTLRPQGSLRDEHHKPTGVPVTITTKPSVTFNIRTSKDPEHEGCNLSLGDSKLLENCGFNMTAKT 87

  Fly   154 RLMIHGW-MSQSRGSF----NRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELA 213
            ..:|||| ||   |.|    ::.|.....::.|.||:||||...:..: |...|......|..:|
  Rat    88 FFIIHGWTMS---GMFESWLHKLVSALQTREKEANVVVVDWLPLAHQL-YIDAVSNTRVVGRRVA 148

  Fly   214 QFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDP 278
            ..:..|..:.......::|||:||||.:||.||..:|.. |..|..||||||.|.......|:.|
  Rat   149 GMLNWLQEKGEFSLGDVHLIGYSLGAHVAGYAGNFVKGT-VGRITGLDPAGPMFEGVDINRRLSP 212

  Fly   279 SDAKYVESMHT-----SANFGFRRPTGSATFYPNYGAYQHSCYY---------------LGCSHI 323
            .||.:|:.:||     ..:.|.|.|.|....|||.|.:|..|.:               :.|.|.
  Rat   213 DDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHE 277

  Fly   324 RSYQMFAES-INSPLGFWGTPCIRDNGRWQCDYSQRQSIQMAGEPSIHKEGI------------- 374
            |:..:|.:| :|..         :.:..:||.           :|:..|.||             
  Rat   278 RAVHLFVDSLVNQD---------KPSFAFQCT-----------DPNRFKRGICLSCRKNRCNNIG 322

  Fly   375 -------------FYVKTSSSDPF 385
                         .|:||.:..||
  Rat   323 YNAKKMRKKRNSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 84/333 (25%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 83/315 (26%)
lipo_lipase 53..488 CDD:132274 85/319 (27%)
Heparin-binding. /evidence=ECO:0000250 327..339 1/11 (9%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.