DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Lipi

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:344 Identity:102/344 - (29%)
Similarity:150/344 - (43%) Gaps:68/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TCDKDLSESRGIGKFLDL--PFIKKIASNLNPFGSKKLRMHFYLFKREFPECGR---EVDFSIER 140
            || .:.|:|..:....||  |.:|               ::..::.|...:|..   |.:.|:..
  Rat    36 TC-LEFSKSNAMNSLKDLFYPTVK---------------INLLMYSRNNAKCAEPLFESNNSVNA 84

  Fly   141 KWRHCGFNASLPTRLMIHGWMSQSRGS---FNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVV 202
            :     ||.|..|..:|||:  :..||   :......|:||:.:.|:|||||:..:....|...|
  Rat    85 R-----FNPSKKTIWIIHGY--RPLGSTPMWIHKFTKAFLKQEDVNLIVVDWNQGATTFIYGRAV 142

  Fly   203 KLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKF 267
            |........|.::|.|| ...||..|:.:.||.||||.|.|..|| |...::..|..||||||||
  Rat   143 KNTRKVAEILREYIENL-LIHGASLDNFHFIGMSLGAHICGFVGK-LFQGQLGRITGLDPAGPKF 205

  Fly   268 RHRGTEFRIDPSDAKYVESMHT-SANFGFRRPTGSATFYPNYGAYQHSC--------YYLGCSHI 323
            ..:.:..|:|.:|||:|:.:|: |..||...|:|...||||.|..|..|        .|:.|.|.
  Rat   206 SGKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSGHIDFYPNGGRNQPGCPTSLLSGMDYIKCDHQ 270

  Fly   324 RSYQMFAESINSPLGFWGTPC--IRDNGRWQC--------DYSQRQSIQMAGEPSIHKEGI---- 374
            |:..:|.|:..:...|...||  .||.....|        |...|..||    .::.||.:    
  Rat   271 RAVHLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGNLYKDSCPRLGIQ----ANLWKEELKKKT 331

  Fly   375 --------FYVKTSSSDPF 385
                    .::.|||.:||
  Rat   332 EEWPLRTTAFLDTSSQNPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 90/301 (30%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 91/316 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.