DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Pnlip

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:329 Identity:90/329 - (27%)
Similarity:144/329 - (43%) Gaps:44/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DLPFIKKIASNLN--PFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHG 159
            |.|:...|...|.  |:...::...|.|:..|..:..:::. |.....|:..|..:..||::|||
  Rat    30 DAPWSGTIDRPLKALPWSPAQINTRFLLYTNENQDNYQKIT-SDASSIRNSNFKTNRKTRIIIHG 93

  Fly   160 WMSQSRGSFNRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFG 224
            ::.:...::..|:.....|....|.|.|||...| ...|....:.:...|||:|..:..|....|
  Rat    94 FIDKGEENWLSDMCKNMFKVESVNCICVDWKGGS-RATYTQATQNVRVVGAEVALLVNVLKSDLG 157

  Fly   225 ADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHT 289
            ...|:::|||||||:.:||.||||.... :..|..||.|.|.|:....|.|:||:||::|:::||
  Rat   158 YSPDNVHLIGHSLGSHVAGEAGKRTFGA-IGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHT 221

  Fly   290 SA-------NFGFRRPTGSATFYPNYGAYQHSCY-------------------YLGCSHIRSYQM 328
            .|       .||..:..|...|:||.|.....|.                   :..|:|:|||:.
  Rat   222 DAAPIIPNLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKY 286

  Fly   329 FAESINSPLGFWGTPCIRDN----------GRWQCDYSQRQSIQMAGE-PSIHKEGIFYVKTSSS 382
            :.:||.:|.||.|..|...|          |...|......:.:..|: ..::::  ||:.|...
  Rat   287 YTDSIVNPTGFSGFSCSSYNVFSANKCFPCGSEGCPQMGHYADKYPGKTKELYQK--FYLNTGDK 349

  Fly   383 DPFA 386
            ..||
  Rat   350 SNFA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 83/301 (28%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 88/326 (27%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.