DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and LIPH

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:308 Identity:83/308 - (26%)
Similarity:132/308 - (42%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHG---------WMSQSRGSFNRD 171
            |.:...|:.|:...|.:.::.|     .....|.:..|..::||         ||.        |
Human    39 LNVRLMLYTRKNLTCAQTINSS-----AFGNLNVTKKTTFIVHGFRPTGSPPVWMD--------D 90

  Fly   172 VKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHS 236
            :....|...:.||:||||:..:..:.|.............|.:||..:..: ||..|.:|:||.|
Human    91 LVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAE-GASLDDIYMIGVS 154

  Fly   237 LGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSAN-FGFRRPTG 300
            |||.|:|..|: :....:..|..||||||.|..:..:.|:|||||::|:.:|:..: .|::.|.|
Human   155 LGAHISGFVGE-MYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPLG 218

  Fly   301 SATFYPNYGAYQHSC--------YYLGCSHIRSYQMFAESINSPLGFWGTPC--IRD--NGRW-Q 352
            :..||||.|..|..|        .|..|.|.||..::..|:.........||  .:|  ||:. .
Human   219 NIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVS 283

  Fly   353 CDYSQRQSIQMAG-------------EPSIHKEGIFYVKTSSSDPFAL 387
            |..||::|..:.|             :|.:.|.   :..|:...||.:
Human   284 CGTSQKESCPLLGYYADNWKDHLRGKDPPMTKA---FFDTAEESPFCM 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 81/300 (27%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 78/278 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.