DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Lipg

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:328 Identity:89/328 - (27%)
Similarity:138/328 - (42%) Gaps:54/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SNLNPFGSKKLRMH--------------FYLFKREFPEC-GREVDFSIERKWRHCGFNASLPTRL 155
            :.|.|.||.:...|              |.:...:.||. |..:.....:...:||||.:..|..
Mouse    23 TTLRPQGSLRDEHHKPTGVPATARPSVAFNIRTSKDPEQEGCNLSLGDSKLLENCGFNMTAKTFF 87

  Fly   156 MIHGW-MSQSRGSF----NRDVKNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQF 215
            :|||| ||   |.|    ::.|....:::.:.||:||||...:..: |...|......|..:|..
Mouse    88 IIHGWTMS---GMFESWLHKLVSALQMREKDANVVVVDWLPLAHQL-YTDAVNNTRVVGQRVAGM 148

  Fly   216 IRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSD 280
            :..|..:......:::|||:||||.:||.||..:|.. |..|..||||||.|.......|:.|.|
Mouse   149 LDWLQEKEEFSLGNVHLIGYSLGAHVAGYAGNFVKGT-VGRITGLDPAGPMFEGVDINRRLSPDD 212

  Fly   281 AKYVESMHT-----SANFGFRRPTGSATFYPNYGAYQHSCYY---------------LGCSHIRS 325
            |.:|:.:||     ..:.|.|.|.|....|||.|.:|..|.:               :.|.|.|:
Mouse   213 ADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDFQPGCGFNDVIGSFAYGTISEMVKCEHERA 277

  Fly   326 YQMFAES-INSPLGFWGTPCIRDNGRWQ------CDYSQRQSIQMAGEPSIHKEGI-FYVKTSSS 382
            ..:|.:| :|.....:...| .|:.|::      |..::..:|....:....|... .|:||.:.
Mouse   278 VHLFVDSLVNQDKPSFAFQC-TDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAG 341

  Fly   383 DPF 385
            .||
Mouse   342 MPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 83/312 (27%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 82/296 (28%)
lipo_lipase 51..485 CDD:132274 84/300 (28%)
Heparin-binding. /evidence=ECO:0000250 325..337 2/11 (18%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.