DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Lipc

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:291 Identity:81/291 - (27%)
Similarity:120/291 - (41%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PFGS-----------KKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQ 163
            |||.           ||....|.||:.|....|..:........:.||||:|.|..::||||...
Mouse    30 PFGRSLGATEASKPLKKPETRFLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSGS 94

  Fly   164 SRGSFNRDVKNAYLKKG-------------------EYNVIVVDWSASSANINYFSVVKLIETFG 209
            ...:..:|..:.|...|                   ..||.:||| .|.|..:|...|:.....|
Mouse    95 ESATVGKDSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGLVDW-ISLAYQHYTIAVQNTRIVG 158

  Fly   210 AELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRLK-PVKVNTIFALDPAGPKFRHRGTE 273
            .::|..:..|..........::|||:||||.::|.||..:. ..|:..|..||||||.|......
Mouse   159 QDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPMFEGTSPN 223

  Fly   274 FRIDPSDAKYVESMHT------SANFGFRRPTGSATFYPNYGAYQHSCYYL-------------- 318
            .|:.|.||.:|:::||      ..:.|.::|.....||||.|::|..|::|              
Mouse   224 ERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSFQPGCHFLELYKHIAEHGLNAI 288

  Fly   319 ----GCSHIRSYQMFAESI-NSPLGFWGTPC 344
                .|:|.||..:|.:|: :|.|...|..|
Mouse   289 TQTIKCAHERSVHLFIDSLQHSDLQSIGFQC 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 76/274 (28%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 81/291 (28%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.