DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6675 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:316 Identity:86/316 - (27%)
Similarity:140/316 - (44%) Gaps:47/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKN 174
            |:..:.:...|.|:..|.|...:::..:.....:...|.....||.::||::.:....:..|:..
  Rat    59 PWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCK 123

  Fly   175 AYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGA 239
            ...:..:.|.|.|||...| ...|..........|||:|..::.|:.:.|...::::||||||||
  Rat   124 KMFQVEKVNCICVDWRRGS-RTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGA 187

  Fly   240 QIAGSAGKRLKPVKVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSA-------NFGFRR 297
            .:.|.||:||:. .|..|..||||.|.|:....|.|:|||||.:|:.:||.:       .||..:
  Rat   188 HVVGEAGRRLEG-HVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQ 251

  Fly   298 PTGSATFYPNYGAYQHSCY-------------------YLGCSHIRSYQMFAESINSPLGFWGTP 343
            ..|...|:||.|.....|.                   ::.|:|:|||:.:|.||.:|.||.|.|
  Rat   252 KVGHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPDGFLGYP 316

  Fly   344 C-----IRDNGRWQC---------DYSQRQSIQMAGEPSIHKEGIFYVKTSSSDPF 385
            |     .:.|..:.|         .|:.    |..|:.:..::.: |:.|..|..|
  Rat   317 CSSYEKFQQNDCFPCPEEGCPKMGHYAD----QFEGKTATVEQTV-YLNTGDSGNF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 83/304 (27%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 85/314 (27%)
Pancreat_lipase_like 65..363 CDD:238363 83/304 (27%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.